Details for Arabidopsis Locus AT1G74230

Position : Chr1 ( 5`- 27914699 .. 27917083 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74230

Protein [Map View]
MAFLSKVGRLFSQTSSHVTASSSMLQSIRCMSSSKIFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFV
TFTSTEEASNAMQLDGQDLHGRRIRVNYATERGSGFGGRGFGGPGGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAG
GGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGGSENFAQGSSTNAGFDDKFESNQPLGND
TDHQTESGLGGDEQFGGSDNQFGDAENGNTENGPVGFDQTDDGDVAKRA*

DNA
ATGGCTTTCTTAAGTAAAGTTGGAAGGTTATTCAGTCAGACCAGCAGCCATGTCACTGCCTCTAGCTCGATGCTACAGAG
CATCCGTTGCATGTCTTCATCAAAAATCTTTGTTGGAGGTATCTCCTACAGCACTGATGAGTTTGGCTTAAGAGAAGCTT
TTAGCAAATATGGAGAAGTTGTTGATGCAAAGATTATTGTGGACCGTGAAACAGGCAGATCTAGGGGCTTTGCTTTCGTA
ACATTTACTTCGACTGAGGAGGCTAGTAATGCCATGCAATTGGATGGACAGGACCTTCATGGTCGAAGAATTAGGGTGAA
TTATGCAACTGAAAGAGGAAGTGGGTTTGGAGGAAGGGGATTCGGTGGTCCTGGTGGTGGTTATGGTGCTTCAGATGGTG
GTTATGGTGCTCCAGCTGGTGGTTATGGAGGTGGTGCCGGTGGTTACGGAGGCAACTCTTCTTATAGTGGAAATGCTGGG
GGTGGTGGTGGTTATGGTGGTAACTCTTCCTATGGTGGAAATGCTGGTGGTTATGGAGGTAACCCTCCTTATAGTGGCAA
TGCTGTTGGTGGTGGCGGTGGCTATGGAAGCAATTTTGGCGGCGGCGGTGGATATGGTGTTGCAGGTGGTGTTGGTGGAA
GTGAAAACTTTGCCCAAGGCAGCTCCACTAATGCTGGCTTTGATGACAAGTTTGAGAGCAACCAACCATTAGGCAATGAT
ACGGATCATCAGACTGAAAGCGGTTTGGGAGGCGATGAACAATTTGGTGGCAGTGACAATCAATTTGGAGATGCAGAGAA
CGGTAACACAGAGAATGGTCCAGTTGGGTTTGATCAAACTGACGATGGCGATGTTGCCAAGAGAGCCTAG