Details for Arabidopsis Locus AT1G74180

Position : Chr1 ( 5`- 27897197 .. 27900908 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74180

Protein [Map View]
MERKVFSGQNLIWVMLLLVQLRGYKCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDTKSNCCRWEGLKCNQTSGR
IIELSIGQTNFKESSLLNLSLLHPFEELRSLNLSGEIYNEFNGLFDDVEGYESLRRLRNLEILDLSSNSFNNSIFPFLNA
ATSLTTLFIQSNYIGGPLPIKELKNLTKLELLDLSRSGYNGSIPEFTHLEKLKALDLSANDFSSLVELQELKVLTNLEVL
GLAWNHLDGPIPKEVFCEMKNLRQLDLRGNYFEGQLPVCLGNLNKLRVLDLSSNQLSGNLPASFNSLESLEYLSLSDNNF
EGFFSLNPLANLTKLKVFRLSSTSEMLQVETESNWLPKFQLTVAALPFCSLGKIPNFLVYQTNLRLVDLSSNRLSGDIPT
WLLENNPELKVLQLKNNSFTIFQIPTIVHKLQVLDFSANDITGVLPDNIGHVLPRLLHMNGSHNGFQGNLPSSMGEMNDI
SFLDLSYNNFSGELPRSLLTGCFSLITLQLSHNSFSGPILPIQTRLTSLIVLRMHNNLFTGEIGVGLRTLVNLSIFDASN
NRLTGLISSSIPPDSSHLIMLLLSNNLLEGTLPPSLLAIHHLNFLDLSGNLLSGDLPSSVVNSMYGIKIFLHNNSFTGPL
PVTLLENAYILDLRNNKLSGSIPQFVNTGKMITLLLRGNNLTGSIPRKLCDLTSIRLLDLSDNKLNGVIPPCLNHLSTEL
GEGIGLSGFSQEISFGDSLQMEFYRSTFLVDEFMLYYDSTYMIVEIEFAAKQRYDSFSGGTLDYMYGLDLSSNELSGVIP
AELGDLSKLRALNLSRNLLSSSIPANFSKLKDIESLDLSYNMLQGNIPHQLTNLTSLAVFNVSFNNLSGIIPQGGQFNTF
NDNSYLGNPLLCGTPTDRSCEGKKNTKEADNGGEEEEEDDDDEAAIDMVVLYWTTGSTYAIALIGILVLMCFDCPWRRTW
LCIVDAFIASGKSMFS*

DNA
ATGGAAAGGAAGGTGTTCTCGGGTCAAAACCTGATATGGGTTATGCTACTGTTGGTACAACTACGTGGATACAAATGCTG
TATTGAAAAAGAAAGGAAAGCTTTGTTGGAGCTCAAGAAATACATGATCTCAAAAACTGCAGATTGGGGCCTTGACTCTG
TTCTCCCTACTTGGACTAATGATACAAAGAGCAATTGTTGTCGCTGGGAGGGCCTTAAGTGCAATCAAACAAGTGGGCGG
ATTATCGAGCTTTCCATTGGTCAGACGAACTTTAAAGAGAGTTCTCTTTTAAATCTTTCTTTGCTGCATCCGTTTGAAGA
GCTTCGAAGTTTGAACTTATCCGGGGAAATATACAACGAATTCAATGGCTTGTTTGATGATGTTGAAGGTTATGAAAGCT
TAAGGAGATTAAGAAACCTGGAGATTTTGGATCTCTCTTCAAATAGTTTCAACAACAGCATCTTTCCCTTTCTTAATGCT
GCTACATCACTTACAACTCTTTTTATTCAGAGTAACTACATCGGTGGCCCCTTACCTATTAAAGAACTTAAAAACCTTAC
AAAGTTGGAGCTGCTGGACCTCAGTAGAAGTGGATATAACGGCTCCATCCCAGAGTTTACTCACCTGGAAAAGCTGAAAG
CTCTGGATCTAAGTGCCAATGATTTTTCCAGCTTAGTGGAATTGCAAGAACTAAAGGTTTTGACGAACTTGGAAGTCCTG
GGTCTTGCTTGGAATCATCTCGACGGACCAATACCAAAAGAAGTTTTTTGTGAAATGAAGAATTTGCGTCAGCTTGATCT
CCGTGGAAATTATTTCGAAGGTCAGCTTCCTGTGTGTTTAGGTAACTTGAACAAGCTGCGGGTTCTTGATCTCTCATCAA
ACCAGTTAAGTGGAAATCTACCAGCTAGTTTCAATAGCCTCGAGTCCCTCGAATATCTATCATTGTCAGATAATAACTTT
GAAGGCTTCTTCTCACTCAATCCACTCGCCAACCTCACAAAGCTCAAGGTGTTCAGACTTTCGTCAACATCTGAGATGTT
ACAAGTAGAGACAGAGAGCAATTGGCTGCCAAAATTTCAACTGACAGTTGCTGCACTACCCTTTTGCAGCTTGGGGAAAA
TCCCTAATTTTCTCGTCTACCAAACAAATTTGCGTCTAGTTGATCTATCCAGCAATAGATTATCCGGAGACATTCCTACC
TGGCTGTTGGAGAATAATCCAGAGCTTAAAGTCTTACAGTTGAAGAATAATTCCTTCACTATCTTTCAGATTCCTACAAT
AGTGCATAAGTTGCAGGTCTTGGATTTTTCAGCAAATGATATCACCGGAGTGCTCCCTGATAATATTGGCCATGTGCTTC
CAAGGCTGCTACATATGAATGGATCTCATAATGGGTTTCAAGGGAATCTTCCATCGTCCATGGGTGAGATGAATGACATT
TCATTCCTGGACTTGTCTTACAATAATTTCTCTGGGGAGCTACCTAGAAGCTTATTAACAGGTTGTTTTTCATTAATAAC
CCTGCAGCTCTCTCACAACAGTTTTAGTGGCCCTATTCTTCCAATACAAACGAGACTAACTTCATTGATCGTATTGAGGA
TGCATAACAACCTATTTACCGGAGAGATCGGAGTCGGTTTGCGTACCTTGGTTAATTTGTCAATATTTGATGCGTCGAAC
AATCGTCTCACAGGTCTTATCTCAAGTTCGATACCCCCCGACTCGTCTCATCTGATTATGTTATTGCTATCAAACAATCT
CTTAGAAGGTACGTTGCCACCTTCTCTGCTAGCCATTCATCATCTTAATTTTCTGGACCTCTCTGGAAACCTATTATCTG
GAGACCTACCGTCGTCAGTTGTTAATTCTATGTACGGGATAAAGATATTCCTTCATAACAACAGCTTCACGGGGCCACTT
CCTGTCACGTTGTTGGAAAATGCTTACATACTTGATTTGCGGAATAATAAACTCTCTGGGAGTATCCCACAGTTTGTCAA
CACCGGGAAAATGATAACTTTATTGTTGAGGGGGAACAATTTAACAGGATCTATACCAAGGAAGCTGTGTGATTTGACCA
GCATCAGACTTTTAGATCTTTCAGACAACAAGCTCAATGGCGTCATACCTCCATGCCTCAATCATTTATCAACTGAATTG
GGAGAAGGGATTGGGTTGAGTGGCTTCTCTCAGGAGATTAGCTTTGGAGACAGCCTTCAGATGGAATTTTACAGATCCAC
ATTTTTGGTAGATGAGTTCATGCTATACTATGATTCTACATATATGATTGTTGAAATCGAATTTGCAGCAAAGCAAAGGT
ATGACTCTTTCAGTGGAGGAACACTTGACTATATGTATGGGTTGGATCTATCAAGCAATGAATTAAGTGGTGTTATCCCA
GCAGAGCTTGGAGATCTCTCGAAACTACGAGCCCTGAATCTATCTCGCAATTTATTGTCGAGTTCTATACCAGCTAACTT
CTCCAAACTGAAGGACATTGAGAGCCTTGATCTTTCTTATAACATGTTACAGGGAAACATTCCTCACCAACTAACCAACC
TCACTTCTCTTGCTGTTTTCAACGTCTCTTTCAACAATTTATCAGGAATCATTCCTCAAGGAGGACAGTTTAACACCTTC
AACGATAACAGCTACTTAGGAAATCCTCTTCTTTGTGGGACACCGACCGATAGAAGTTGTGAAGGTAAGAAGAACACAAA
GGAAGCAGATAACGGAGGAGAAGAAGAAGAAGAAGATGATGATGATGAAGCTGCTATTGACATGGTGGTCTTGTATTGGA
CTACTGGTTCAACTTATGCGATTGCGTTGATCGGCATTCTTGTACTTATGTGCTTCGATTGTCCTTGGCGTCGGACATGG
CTCTGCATTGTCGACGCTTTCATAGCCTCTGGGAAAAGTATGTTTTCTTGA