Details for Arabidopsis Locus AT1G74160

Position : Chr1 ( 5`- 27886426 .. 27891431 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74160

Protein [Map View]
MAAKLLHSLADDSADLQKQIGCMNGIFQIFDRHHVLTGRRKSLTLGNGNAININYERDSVDTIYQQKETFQDSNIGGNVK
EKRRVSTESSRVSFSSSCSSSPSSSEFNRGVQPDASAYDRANFQESPTSDPEMTEGNGFSHLGLDLRDVVRDSMYREARG
LLSKTPMTREEVVRQSRREDSPRPYGLKQSTPMDLNESFRVLARLRETSQHYNELGMKDAPRYSVDSHDTLKSRQKLKEL
PRLSLDSRERATRNSSVDPKSSKLSESFSESCSSSSKKRPPSVVAKLMGLETLPGSPLGRDIHQFGLNKTNISDQNDDPF
SRSLREKNLNRAIRFSPSSPRSLGKDPASPRWRNSDFVMKPLSNTRFPVEPAPWKHADRNRVLQKQASMPVKAKPYEAPN
FPPTVYSEMERRLNDLEFKHSGKDLRALKQILESMQSKGFLDTEKQQQSTNFAVQRDYERENSATSNHAMSSRTRVQSSS
SNQVYQSPIVIMKPAKLVEKAGIPASSLIPIHSLTGIKKIRREKPDDKGTSASNSKRVTKDCSPGNRRAESCTSSFDKKS
DSRNVRSSSKKPQQVSKESASKSSGSVSPRLQQKKLEYDKRSRPPTPPDSSKSRKPSNQQLVESTSPGGRRRPKGQKSLQ
QVDDQLSQASNESRTSSHGICTQSETEASACVEKSTEADGGKSPSVIEAAKAVVSNLMQNKSSPRFSEDGLSANLSLVAL
EHPSPISVLDASTYRETEPSPVKTQGNVAHDFGDENCEDQWNPAYSFSETTSSFSPEINRKKLQNVEHLVQKLRRLNSSH
DEASQDYIASLCENADPTTDHRYISEILLASGLLLRDLGSGLTTFQLHPSGHPINPELFFVLEQTKGSSTTHLLHKEESK
VLKNEKLNRKLVFDLVNEILVEKLASVEATTNPLMKSYAKVTKKAVSAQQLLKELCSAIETQQKQATKRSENFLLEEEDD
FLKSILAEDVTIRSGNWADFSGEMSGLVLDVERLVFKDLVNEIVHAETSRLQAKSGRRRTLFADQ*

DNA
ATGGCTGCGAAGCTTCTGCATTCATTGGCAGATGATAGTGCAGATCTGCAGAAGCAAATTGGATGTATGAATGGGATTTT
TCAAATCTTTGATCGTCACCATGTTCTTACTGGCCGACGAAAAAGTCTTACTTTAGGTAATGGAAATGCCATTAACATCA
ATTATGAAAGAGACTCTGTTGATACAATTTATCAACAAAAAGAAACTTTTCAGGACTCCAACATTGGTGGGAATGTGAAA
GAGAAGCGAAGGGTTTCAACAGAATCATCTAGAGTTTCTTTCTCATCTTCGTGCTCTTCCTCCCCATCGTCTTCTGAGTT
CAATAGAGGAGTTCAACCTGACGCTTCTGCGTATGACCGAGCTAATTTTCAAGAATCTCCTACAAGTGATCCTGAGATGA
CTGAAGGGAATGGATTTTCACATTTGGGACTTGACCTCAGAGATGTTGTGAGAGACTCAATGTACAGAGAAGCCAGAGGG
CTTTTGAGTAAGACTCCAATGACTAGAGAGGAAGTAGTTAGACAGAGCAGACGAGAGGATTCTCCAAGGCCTTATGGTTT
GAAGCAATCAACTCCCATGGATCTCAATGAGTCCTTCAGAGTTCTAGCAAGACTTAGAGAAACATCTCAACATTATAACG
AGCTTGGCATGAAAGATGCGCCTCGTTACTCAGTTGATTCTCATGATACGTTGAAATCCAGACAGAAGCTGAAAGAGTTG
CCTAGGCTTTCGCTGGATAGTAGAGAACGAGCGACGCGAAACTCCAGTGTTGATCCCAAATCAAGTAAGCTTTCAGAAAG
TTTCAGTGAAAGCTGTTCAAGCAGTAGCAAGAAACGGCCTCCCAGTGTTGTAGCAAAGCTCATGGGATTGGAGACATTGC
CCGGTTCTCCATTGGGTAGAGACATTCATCAGTTTGGTCTGAACAAAACCAACATCTCTGACCAAAATGACGATCCATTC
TCAAGATCATTGAGGGAGAAAAATCTGAACCGTGCAATCCGTTTTTCTCCTAGCTCACCGAGAAGCTTGGGGAAGGACCC
GGCTTCTCCAAGATGGAGAAACTCTGATTTTGTTATGAAACCTCTATCAAATACAAGATTCCCCGTTGAACCAGCTCCAT
GGAAACACGCTGATAGAAACCGAGTTTTGCAAAAGCAAGCTAGCATGCCTGTGAAAGCGAAGCCGTATGAAGCACCTAAT
TTTCCTCCTACTGTGTACAGTGAAATGGAGCGGAGATTGAATGATCTTGAGTTCAAACATTCTGGAAAAGATCTGCGAGC
CCTTAAACAAATATTAGAGTCTATGCAGTCAAAAGGTTTCCTAGATACTGAGAAACAACAACAATCCACAAACTTTGCAG
TTCAAAGAGATTATGAAAGAGAAAATTCTGCAACTTCCAACCATGCAATGTCATCCAGAACGAGAGTTCAGTCTTCTTCA
TCTAACCAGGTATATCAATCCCCGATTGTGATTATGAAACCTGCCAAGCTTGTTGAGAAGGCTGGTATTCCTGCGTCATC
CCTTATTCCCATTCACAGCCTAACTGGCATCAAGAAGATCCGTAGAGAAAAACCTGATGATAAAGGAACTTCAGCAAGTA
ATAGTAAACGGGTGACAAAAGATTGTAGTCCTGGAAACCGAAGAGCTGAATCATGTACCAGCTCGTTTGATAAGAAATCT
GACAGCAGAAATGTGCGGTCTTCTTCAAAAAAGCCTCAGCAGGTTTCCAAAGAAAGTGCTTCAAAGAGTTCAGGATCTGT
AAGTCCAAGATTACAGCAGAAGAAGCTTGAGTATGATAAGCGTTCACGGCCACCAACCCCTCCTGATTCTAGCAAATCAA
GGAAACCGTCAAACCAACAACTTGTGGAATCTACTTCTCCTGGTGGCAGACGTAGACCCAAGGGTCAGAAGAGTTTGCAG
CAAGTTGATGACCAACTTAGTCAAGCAAGCAATGAATCTAGGACGTCAAGTCATGGCATTTGTACTCAATCCGAAACAGA
AGCCTCTGCTTGTGTAGAAAAATCTACTGAAGCTGATGGTGGTAAAAGTCCATCTGTAATCGAGGCAGCCAAAGCTGTAG
TCTCTAACTTAATGCAGAATAAATCCAGTCCAAGGTTTAGTGAAGATGGATTGTCAGCTAACCTTTCACTAGTTGCTTTG
GAACATCCAAGTCCTATTTCTGTTCTCGACGCTTCAACGTACAGAGAGACTGAACCATCACCCGTGAAGACACAAGGTAA
TGTTGCCCATGATTTTGGTGATGAAAATTGTGAGGACCAGTGGAATCCAGCATACAGTTTCTCAGAAACCACATCAAGCT
TTTCGCCAGAGATAAACCGTAAGAAGCTACAGAATGTTGAGCACTTGGTTCAAAAGCTCAGACGATTGAACTCTAGCCAT
GATGAAGCCAGCCAAGATTATATTGCATCGCTCTGTGAGAACGCAGATCCTACCACCGATCATAGATACATTTCTGAGAT
TCTATTAGCCTCGGGTCTTCTCCTAAGAGACCTTGGCTCAGGATTGACAACGTTTCAACTTCACCCTTCTGGCCACCCAA
TCAATCCTGAGCTGTTCTTTGTTCTTGAGCAGACAAAGGGAAGCAGCACTACGCATCTGTTACACAAAGAAGAAAGTAAG
GTTCTGAAAAATGAGAAGCTCAACCGGAAACTTGTGTTTGATCTCGTTAATGAGATTCTGGTGGAGAAACTAGCGTCAGT
TGAAGCCACGACGAATCCATTGATGAAGTCATATGCTAAGGTGACTAAGAAAGCCGTGAGTGCGCAACAACTACTGAAAG
AACTGTGTTCAGCGATAGAAACACAGCAAAAGCAAGCCACAAAGAGATCAGAAAACTTTTTATTGGAAGAAGAAGACGAC
TTCTTGAAAAGTATACTTGCTGAAGATGTGACGATTCGATCTGGGAACTGGGCAGACTTCAGTGGAGAAATGTCAGGATT
GGTGCTGGATGTTGAGAGGCTTGTCTTCAAGGATCTGGTTAATGAAATCGTGCATGCAGAGACAAGCCGTCTGCAAGCAA
AGTCAGGAAGGCGACGAACGCTTTTTGCTGACCAGTAG