Details for Arabidopsis Locus AT1G74080

Position : Chr1 ( 5`- 27855699 .. 27857534 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74080

Protein [Map View]
MVRTPCCRAEGLKKGAWTQEEDQKLIAYVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYLRPDIKRGEFSQDEEDSIIN
LHAIHGNKWSAIARKIPRRTDNEIKNHWNTHIKKCLVKKGIDPLTHKSLLDGAGKSSDHSAHPEKSSVHDDKDDQNSNNK
KLSGSSSARFLNRVANRFGHRINHNVLSDIIGSNGLLTSHTTPTTSVSEGERSTSSSSTHTSSNLPINRSITVDATSLSS
STFSDSPDPCLYEEIVGDIEDMTRFSSRCLSHVLSHEDLLMSVESCLENTSFMREITMIFQEDKIETTSFNDSYVTPINE
VDDSCEGIDNYFG*

DNA
ATGGTACGGACGCCGTGTTGTAGAGCAGAAGGGTTGAAGAAAGGAGCATGGACTCAAGAAGAAGACCAAAAGCTTATCGC
CTATGTTCAACGACATGGTGAAGGCGGTTGGCGAACCCTTCCGGACAAAGCTGGACTCAAAAGATGTGGCAAAAGCTGCA
GATTGAGATGGGCGAATTACTTAAGACCTGACATTAAACGTGGAGAGTTTAGCCAAGACGAGGAAGATTCCATCATCAAC
CTCCACGCCATTCATGGCAACAAATGGTCGGCCATAGCTCGTAAAATACCAAGAAGAACAGACAATGAGATCAAGAACCA
TTGGAACACTCACATCAAGAAATGTCTGGTCAAGAAAGGTATTGATCCGTTGACCCACAAATCCCTTCTCGATGGAGCCG
GTAAATCATCTGACCATTCCGCGCATCCCGAGAAAAGCAGCGTTCATGACGACAAAGATGATCAGAATTCAAATAACAAA
AAGTTGTCAGGATCATCATCAGCTCGGTTTTTGAACAGAGTAGCAAACAGATTCGGTCATAGAATCAACCACAATGTTCT
GTCTGATATTATTGGAAGTAATGGCCTACTTACTAGTCACACTACTCCAACTACAAGTGTTTCAGAAGGTGAGAGGTCAA
CGAGTTCTTCCTCCACACATACCTCTTCGAATCTCCCCATCAACCGTAGCATAACCGTTGATGCAACATCTCTATCCTCA
TCCACGTTCTCTGACTCCCCCGACCCGTGTTTATACGAGGAAATAGTCGGTGACATTGAAGATATGACGAGATTTTCATC
AAGATGTTTGAGTCATGTTTTATCTCATGAAGATTTATTGATGTCCGTTGAGTCTTGTTTGGAGAATACTTCATTCATGA
GGGAAATTACAATGATCTTTCAAGAGGATAAAATCGAGACGACGTCGTTTAATGATAGCTACGTGACGCCGATCAATGAA
GTTGATGACTCCTGTGAAGGGATTGACAATTATTTTGGATGA