Details for Arabidopsis Locus AT1G74000

Position : Chr1 ( 5`- 27829142 .. 27831431 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G74000

Protein [Map View]
MMRSFVSLISLLLLLSFSSSVLSTKKSSFQKLPVPGNRTGPEAFAFDSTGKGFYTGVTGGKILKYLPKKGYVDFAQITNS
SKSSLCDGALGTTNVEKCGRPAGIAFNTKTGDLYVADAALGLHVIPRRGGLAKKIADSVGGKPFLFLDGLDVDPTTGVVY
FTSFSSTFGPRDVLKAVATKDSTGKFFKYDPSKKVVTVLMEGLSGSAGCAVSSDGSFVLVGQFTKSNIKRYWIKGSKAGT
SEDFTNSVSNPDNIKRIGSTGNFWVASVVNSATGPTNPSAVKVSSAGKVLQTIPLKDKFGDTLVSEVNEYKGQLYIGALF
GPFAGILKL*

DNA
ATGATGAGGTCGTTTGTCTCGTTGATTTCTCTTCTCCTTCTTCTCTCATTTTCTTCATCTGTTCTCTCAACCAAAAAGTC
ATCATTTCAAAAACTTCCGGTGCCAGGAAACAGAACAGGCCCTGAAGCTTTCGCTTTTGATTCCACCGGAAAAGGATTCT
ACACCGGAGTCACCGGCGGTAAAATCCTAAAATATCTTCCAAAGAAAGGTTATGTCGACTTTGCCCAGATCACAAACTCT
TCGAAGTCTTCGTTGTGCGACGGAGCACTTGGAACCACTAACGTCGAAAAATGTGGTCGACCAGCCGGAATAGCCTTCAA
CACGAAAACAGGTGATCTTTACGTCGCAGATGCTGCATTGGGTCTCCACGTCATCCCTCGCCGTGGGGGTTTGGCTAAGA
AGATCGCCGACAGTGTCGGCGGCAAGCCCTTTTTGTTTCTTGACGGGCTTGACGTAGATCCCACTACCGGCGTCGTCTAT
TTCACTTCCTTCAGCTCAACATTTGGCCCTAGGGATGTGTTGAAAGCAGTGGCAACAAAAGACTCGACCGGTAAGTTCTT
CAAATACGATCCATCAAAAAAGGTCGTGACTGTATTGATGGAAGGTCTTAGCGGCTCAGCCGGATGTGCCGTTAGCTCAG
ATGGTTCATTCGTGCTGGTTGGTCAGTTCACAAAAAGTAACATCAAGAGGTATTGGATCAAAGGATCCAAAGCTGGTACT
TCTGAAGACTTCACCAACTCGGTCTCGAACCCTGACAACATCAAGAGGATCGGTTCTACTGGAAACTTTTGGGTTGCTTC
GGTCGTGAACTCAGCCACCGGACCGACAAACCCTTCGGCGGTTAAAGTCAGTTCTGCCGGTAAAGTGCTTCAGACCATTC
CCCTAAAAGACAAGTTTGGGGATACTTTGGTTAGTGAAGTTAACGAATACAAAGGACAGCTTTACATCGGAGCTCTTTTT
GGTCCTTTCGCCGGAATTCTTAAGCTTTAA