Details for Arabidopsis Locus AT1G73980

Position : Chr1 ( 5`- 27820149 .. 27824036 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73980

Protein [Map View]
MALDSSVALSPRRRHGLLRDQVQLIKRKDSGRYEIVPIEDPLSFEKGFYAVIRACQLLAQKNDGLILVGLAGPSGAGKTI
FTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRI
VILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLKTAQIKILNKF
NPFSGFQNPTYILKSSKAVTPEQMKAALSEDFKERTEETYDIYLLPPGEDPEACQSYLRMRNRDGKYNLMFEEWVTDRPF
IISPRITFEVSVRLLGGLMALGYTIATILKRKSHIFDDDKVIVKTDWLEQLNRTYVQVQGKDRTFVKNVADQLGLEGSYV
PHTYIEQIQLERLVNDVLALPDDLKTKLSLDDDTVSSPKEALSRASVDSRMKYLHGGVSKSYTNPRHKVLPNLTRLAVNN
RMLDARAPASPATLPNQGFITQLSDQISTLNERMDEFTSRIEELNSKIPNRIAPSGSQHNLALPIENGNGSVLSFSASAS
QLVRESPLMEEVVLVARGQRQIMHQMDTLSNLLREYVGEKTRIERLDSSRTNSTTQNLESSTVPILLGLAIGCVGIFAYS
RLK*

DNA
ATGGCGCTCGATAGTTCTGTTGCTCTGTCACCTCGCCGGCGGCATGGCTTGTTGCGAGATCAGGTTCAGCTTATAAAAAG
AAAGGACTCTGGAAGATATGAGATAGTTCCAATAGAGGATCCATTGTCTTTTGAAAAAGGTTTCTACGCTGTTATTCGTG
CTTGTCAATTATTGGCTCAGAAGAACGATGGGCTCATTTTGGTTGGGTTAGCTGGTCCTTCTGGAGCTGGCAAAACCATT
TTCACTGAGAAGATTCTCAATTTTATGCCTAGTATTGCTATCATTAACATGGACAACTATAATGATGGTACTCGTGTTAT
CGATGGAAACTTTGATGATCCAAGGTTGACTGACTATGATACACTTCTTGACAATATACATGGTCTAAGGGATGGAAAAC
CTGTTCAGGTTCCAATATATGACTTCAAGTCGAGTTCTCGAATAGGTTACAGAACGCTTGAGGTGCCTAGCTCTCGCATT
GTTATTCTAGAAGGCATATATGCTTTGAGTGAGAAGCTACGGCCTTTGCTAGATCTTCGTGTCTCTGTCACTGGTGGAGT
GCATTTTGATCTTGTTAAGCGTGTTTTGCGGGACATTCAACGTGCTGGCCAGGAACCTGAAGAAATAATCCATCAGATAT
CTGAGACGGTTTATCCTATGTACAAGGCGTTTATTGAACCTGATCTGAAGACAGCTCAGATTAAGATCCTTAATAAGTTC
AACCCATTCAGTGGCTTTCAGAACCCAACATATATTTTAAAGTCATCAAAGGCTGTAACACCCGAACAAATGAAGGCAGC
TCTATCTGAAGATTTCAAGGAACGTACAGAGGAAACTTATGACATCTATCTGTTACCACCAGGCGAGGATCCTGAAGCAT
GCCAATCATACCTCAGAATGAGGAACCGAGATGGAAAATACAATCTCATGTTTGAGGAGTGGGTTACAGATCGTCCATTT
ATTATATCACCCAGAATAACTTTTGAAGTTAGTGTTCGTCTTCTTGGAGGATTAATGGCACTGGGTTATACCATTGCAAC
AATCCTGAAAAGAAAGAGTCATATCTTTGATGATGACAAGGTAATTGTGAAAACTGATTGGTTGGAACAACTGAATCGGA
CATATGTACAGGTACAAGGTAAAGACCGTACCTTTGTCAAAAATGTGGCAGACCAACTTGGACTGGAAGGTTCATATGTT
CCACATACATATATTGAACAGATACAGCTGGAGAGGCTTGTGAATGATGTTTTGGCTTTGCCAGATGACTTAAAAACAAA
ACTTAGCTTAGATGATGATACAGTTTCTAGCCCTAAAGAAGCCCTCTCAAGAGCTTCTGTTGATAGTAGAATGAAATATC
TTCACGGCGGCGTATCAAAGTCTTACACAAACCCAAGACACAAAGTCTTGCCTAACTTGACAAGACTTGCTGTTAACAAT
AGAATGTTAGATGCCAGAGCCCCTGCTTCACCGGCCACTCTTCCAAATCAGGGTTTTATCACTCAACTTTCAGACCAAAT
ATCAACACTGAACGAGAGGATGGATGAATTCACATCCCGCATTGAAGAGTTGAATTCCAAGATCCCGAACAGGATAGCTC
CTTCAGGTAGTCAACATAACTTGGCTTTACCAATCGAAAACGGTAATGGGTCTGTCTTATCATTCTCCGCATCCGCATCT
CAGCTCGTAAGGGAATCTCCTCTGATGGAAGAGGTCGTACTGGTTGCTCGTGGACAGCGTCAGATAATGCATCAAATGGA
CACACTGAGTAATCTTCTTCGGGAGTATGTTGGAGAAAAGACTCGCATAGAGAGACTCGACAGCAGCAGAACAAACAGTA
CAACACAAAACCTCGAATCCTCTACTGTACCGATTCTTCTTGGTTTGGCCATTGGCTGTGTGGGCATCTTTGCCTACAGT
CGTCTGAAATAG