Details for Arabidopsis Locus AT1G73890

Position : Chr1 ( 5`- 27787903 .. 27788658 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73890

Protein [Map View]
MASSTLLITLLISLSAFFLRMVLAQVPATCASRLLSLAPCGPFVQGFAQLPAQPCCDSLNQIYSQEATCLCLFLNNTSTL
SPAFPINQTLALQLPPLCNIPANSSTCSSSFPGEAPSDSSSVAPPPSSSTGSQISQGAKNNSRVAATPVAQMAPRPTSFM
GLGYGLKSSGSKSEIQLTIFALAAILPAALLLI*

DNA
ATGGCTTCTTCTACTCTTCTCATCACTCTTTTAATCTCCTTATCAGCATTCTTTCTCCGAATGGTTCTCGCTCAAGTACC
AGCTACATGTGCCTCCAGACTGCTTTCCTTAGCTCCATGTGGTCCATTCGTTCAAGGCTTTGCCCAACTTCCGGCTCAGC
CATGTTGTGACAGCTTAAACCAGATCTATAGCCAAGAAGCAACCTGTCTCTGTCTCTTCCTCAACAACACCTCTACTTTG
TCCCCTGCTTTTCCAATTAATCAAACTCTTGCTCTACAATTGCCTCCGCTTTGCAACATTCCAGCCAATTCATCCACTTG
CTCCTCCTCCTTCCCTGGAGAGGCGCCTAGTGATTCCTCCTCTGTTGCTCCACCACCTTCAAGCTCAACTGGTTCTCAAA
TCTCTCAAGGTGCAAAGAACAACTCTCGTGTCGCTGCTACTCCAGTGGCTCAAATGGCACCAAGACCCACCAGTTTTATG
GGATTAGGTTATGGTTTGAAATCCTCTGGCTCCAAGTCTGAGATTCAGCTAACCATCTTTGCACTCGCAGCGATCTTACC
CGCCGCTCTCCTCCTCATCTGA