Details for Arabidopsis Locus AT1G73885

Position : Chr1 ( 5`- 27786864 .. 27787708 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73885

Protein [Map View]
MALTVSSGGGGARIRCNDLTDSSRNPFSTFRLVNFPNPSRTEQQEEGNEGFDGENPPSQIVINDEDGDRTVVNTRFRGDP
KDAPKFAIKDLPGLEPDPFEGEKWDGLGFFVQYLWAFGILFALISGGLAAGTYNEGATDFKETPVYKEAIQSRDLLDEAE
SSNSEDVFESNPTEVAPTIFQVDLELVVFIML*

DNA
ATGGCTCTCACCGTGAGCAGCGGTGGCGGAGGAGCTAGAATCCGCTGCAACGACCTCACCGATTCTTCTCGTAACCCTTT
CTCCACCTTCCGACTCGTAAACTTCCCTAATCCATCAAGAACCGAACAGCAGGAAGAGGGAAACGAAGGTTTTGACGGCG
AGAACCCGCCGTCTCAGATCGTTATCAACGACGAAGATGGAGATAGAACGGTGGTGAATACTCGATTCAGAGGTGATCCG
AAAGATGCGCCGAAATTTGCCATTAAGGATCTTCCTGGACTTGAACCAGATCCTTTTGAAGGTGAGAAGTGGGATGGTCT
AGGTTTCTTCGTTCAGTACTTGTGGGCTTTCGGAATCCTTTTCGCGCTAATCTCTGGTGGACTTGCGGCGGGGACGTATA
ACGAAGGTGCGACGGATTTCAAGGAGACGCCAGTATATAAAGAGGCGATTCAATCTCGTGACCTTCTTGATGAAGCAGAG
AGTTCAAACTCTGAAGATGTGTTTGAGTCCAACCCAACAGAAGTGGCTCCTACCATATTCCAAGTTGATCTTGAGCTTGT
TGTGTTCATAATGTTATAG