Details for Arabidopsis Locus AT1G73830

Position : Chr1 ( 5`- 27759973 .. 27761588 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73830

Protein [Map View]
MANLSSDFQTFTMDDPIRQLAELSNTLHHFQTFPPPFSSSLDSLFFHNQFPDHFPGKSLENNFHQGIFFPSNIQNNEESS
SQFDTKKRKSLMEAVSTSENSVSDQTLSTSSAQVSINGNISTKNNSSRRGKRSKNREEEKEREVVHVRARRGQATDSHSI
AERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSETDAVESMQKAKARE
AVEMGQGRDGSSVFHSSSWTL*

DNA
ATGGCGAATCTCTCTTCTGATTTTCAGACATTTACAATGGATGATCCCATAAGACAACTAGCAGAACTGAGCAACACGCT
TCATCATTTCCAAACATTTCCTCCTCCTTTCTCTTCTTCTCTCGATTCTCTTTTCTTTCATAATCAATTCCCTGATCATT
TTCCCGGAAAATCTCTCGAGAATAATTTTCATCAAGGGATATTCTTCCCTTCTAATATCCAAAACAACGAAGAGTCTTCT
TCACAATTCGATACCAAGAAGAGAAAATCATTAATGGAAGCTGTTTCTACGTCGGAGAACAGTGTCTCTGATCAAACTCT
CTCTACCTCTTCTGCTCAAGTTTCCATAAATGGAAATATTTCGACAAAAAATAATTCTTCAAGGAGAGGGAAGAGGTCGA
AGAATAGAGAAGAAGAGAAAGAGAGAGAAGTTGTTCATGTTAGAGCTAGAAGAGGCCAAGCCACTGATAGCCACAGCATA
GCAGAACGGGTTCGACGAGGGAAAATAAACGAGAGATTGAAATGCTTGCAAGATATAGTCCCCGGATGTTATAAGACAAT
GGGAATGGCTACTATGCTTGATGAGATAATTAATTACGTCCAGTCCTTACAAAATCAAGTCGAGTTTTTATCTATGAAGC
TTACAGCAGCAAGTTCGTATTATGACTTTAACTCGGAGACTGATGCTGTGGAATCCATGCAGAAGGCAAAGGCACGTGAG
GCAGTGGAGATGGGTCAAGGGAGGGATGGGAGTTCTGTCTTCCATTCATCATCGTGGACCCTTTGA