Details for Arabidopsis Locus AT1G73780

Position : Chr1 ( 5`- 27743872 .. 27744168 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73780

Protein [Map View]
MKGSCTKPVFFTCTILLILIVAQENRVAAVDPCNPAQLSPCLETIMKGSEPSDLCCSKVKEQQHCICQYLKNPNFKSFLN
SPNAKIIATDCHCPYPKC*

DNA
ATGAAGGGTTCTTGCACAAAACCAGTGTTTTTCACTTGTACAATCCTTCTCATTTTAATTGTTGCCCAAGAAAACAGAGT
CGCTGCAGTAGATCCATGTAATCCTGCGCAGCTGAGTCCATGCTTGGAGACCATAATGAAAGGGTCTGAGCCATCGGATC
TGTGTTGCAGCAAGGTGAAGGAGCAACAGCATTGTATCTGCCAGTACTTGAAGAACCCTAACTTCAAATCTTTCCTTAAC
TCCCCAAACGCCAAAATAATCGCCACTGATTGTCATTGTCCGTATCCGAAATGCTAG