Details for Arabidopsis Locus AT1G73770

Position : Chr1 ( 5`- 27742128 .. 27743565 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73770

Protein [Map View]
MRRFLQRVPSLLARNILHSPANFRHLRINNPRVVVPLFERAISRFVFFSSESDSSRGFRTEEVLSKEELKKRIQSFLDDG
NEDAIPDLFEALMIRKLSGKHDDSDDEVMDVVRKYPVNDAHKVDDIDSDIESDGHGDSSDSDIESDDLRDGDSSDSDVEF
DGFNDVGLSDVNIKTDALKANRSSYSYSESD*

DNA
ATGAGACGATTTCTGCAGAGAGTTCCCAGTTTACTGGCTCGAAATATCCTTCACTCACCCGCAAATTTCCGCCATTTGAG
AATCAACAACCCTCGTGTTGTTGTTCCTCTCTTCGAACGAGCTATTTCCCGGTTCGTCTTCTTCTCTTCCGAGTCCGACT
CGTCGCGTGGTTTCAGAACTGAAGAGGTTCTTTCTAAAGAAGAGCTGAAAAAAAGAATTCAAAGCTTTTTGGATGATGGA
AATGAGGATGCTATACCTGATTTATTTGAGGCATTGATGATTAGGAAGTTATCAGGGAAGCACGATGATAGTGATGATGA
AGTGATGGATGTGGTGCGTAAGTATCCAGTTAACGATGCACATAAGGTTGACGATATTGACTCTGATATTGAGAGTGATG
GCCATGGTGATTCGTCTGATTCAGATATTGAGAGTGATGACTTGAGAGATGGTGATTCGTCTGATTCCGATGTAGAGTTT
GATGGTTTCAATGATGTTGGCTTGTCTGATGTCAATATTAAGACTGATGCCCTGAAAGCTAATCGCTCGTCTTATTCTTA
CTCTGAAAGTGATTAA