Details for Arabidopsis Locus AT1G73730

Position : Chr1 ( 5`- 27730031 .. 27732514 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73730

Protein [Map View]
MGDLAMSVADIRMENEPDDLASDNVAEIDVSDEEIDADDLERRMWKDRVRLKRIKERQKAGSQGAQTKETPKKISDQAQR
KKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPAAIAKYEEECLAFGKSDGNR
NSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQSPPYRKPHDLKKMWKVGVLT
AVINHMLPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDNGNSNVTETHRRGNNADRRKPVVNSDSD
YDVDGTEEASGSVSSKDSRRNQIQKEQPTAISHSVRDQDKAEKHRRRKRPRIRSGTVNRQEEEQPEAQQRNILPDMNHVD
APLLEYNINGTHQEDDVVDPNIALGPEDNGLELVVPEFNNNYTYLPLVNEQTMMPVDERPMLYGPNPNQELQFGSGYNFY
NPSAVFVHNQEDDILHTQIEMNTQAPPHNSGFEEAPGGVLQPLGLLGNEDGVTGSELPQYQSGILSPLTDLDFDYGGFGD
DFSWFGA*

DNA
ATGGGCGATCTTGCTATGTCCGTAGCAGACATCAGGATGGAGAATGAGCCTGATGATTTAGCTAGTGATAATGTTGCTGA
GATTGATGTGAGTGATGAAGAGATTGATGCTGACGACCTTGAGAGACGGATGTGGAAAGATCGTGTCAGGCTTAAAAGAA
TCAAAGAGCGACAAAAAGCTGGCTCTCAAGGAGCTCAAACGAAGGAGACACCTAAGAAAATCTCTGATCAAGCTCAGAGG
AAGAAAATGTCTAGAGCTCAAGATGGTATCCTTAAGTACATGTTGAAGCTTATGGAAGTCTGCAAAGTTCGCGGGTTTGT
CTATGGTATAATACCGGAAAAGGGCAAGCCTGTGAGTGGTTCCTCTGACAATATAAGAGCTTGGTGGAAAGAGAAAGTGA
AGTTTGATAAGAACGGTCCTGCTGCTATTGCTAAATACGAAGAGGAGTGTTTAGCGTTTGGGAAATCTGATGGGAATAGG
AATTCACAGTTTGTTCTCCAGGATTTGCAAGATGCTACTTTAGGGTCTTTGTTATCTTCTTTGATGCAACATTGTGATCC
TCCTCAAAGGAAGTATCCGTTGGAGAAAGGGACGCCTCCGCCTTGGTGGCCAACGGGGAATGAAGAATGGTGGGTGAAAC
TCGGTCTGCCTAAAAGCCAGAGTCCTCCTTACCGAAAACCTCATGATCTCAAGAAGATGTGGAAGGTTGGAGTTTTAACG
GCAGTGATCAATCATATGTTACCTGATATTGCAAAGATTAAGAGGCATGTTCGTCAGTCGAAATGTTTACAGGACAAGAT
GACAGCTAAAGAGAGTGCGATTTGGTTGGCGGTTTTGAACCAAGAGGAATCTTTGATTCAGCAGCCTAGCAGTGACAATG
GAAACTCCAATGTGACTGAGACACATCGTAGGGGTAATAACGCTGACAGGAGGAAACCTGTGGTCAACAGTGACAGTGAC
TATGATGTTGATGGGACAGAGGAAGCTTCAGGTTCAGTTTCATCTAAAGACAGTAGAAGAAATCAGATTCAAAAAGAACA
ACCAACAGCCATCTCACATTCAGTAAGAGATCAAGATAAAGCAGAGAAACATCGCAGAAGGAAAAGACCTCGAATTAGAT
CCGGAACTGTCAATCGACAAGAGGAAGAACAACCTGAAGCTCAACAAAGAAACATCTTACCTGATATGAATCATGTTGAT
GCCCCTCTGCTAGAATATAACATCAACGGTACTCATCAAGAGGACGATGTTGTCGACCCAAATATTGCCTTAGGACCAGA
GGATAATGGTCTGGAACTAGTGGTTCCTGAGTTCAATAACAACTATACTTATCTTCCACTTGTTAATGAACAAACTATGA
TGCCTGTAGACGAAAGGCCAATGCTTTATGGACCAAACCCTAACCAAGAGCTTCAATTTGGGTCAGGGTACAACTTCTAC
AATCCCTCTGCAGTGTTTGTACATAACCAGGAAGACGACATTCTCCATACACAGATAGAAATGAATACACAAGCACCACC
TCACAACAGTGGGTTCGAGGAGGCCCCAGGAGGAGTACTTCAACCCCTTGGTTTACTCGGAAATGAAGACGGTGTAACAG
GGAGTGAGTTGCCTCAGTATCAGAGTGGCATTCTGTCTCCATTGACTGACTTGGACTTTGACTATGGTGGTTTTGGTGAT
GATTTCTCATGGTTTGGAGCTTAG