Details for Arabidopsis Locus AT1G73680

Position : Chr1 ( 5`- 27703944 .. 27707518 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73680

Protein [Map View]
MGFSPSSSWFLHPQLHHVVSKMSYFDAFLFYIVHLVDKLGLWHRFPVLLGVAYLGLRRHLHQRYNLVHVGPINGQGYDTD
EFCYRTADGKCNHPSDNTIGSQGSFIGRNMPPSTSQYGFFCQYFFFPENLEKKIVVATKLLARKRFIDNGDQFNVIACSW
IQFMIHDWVDHLEDTHQIELEAPEEVASGCPLKSFKFLRTKKVPTDDHHKSGAVNTRTPWWDGSVIYGNDETGMRRVRVF
KDGKLKISGDGLLERDERGVPISGDIRNSWSGFSLLQALFVKEHNSVCDMLKERYPDFDDEKLYRTARLVTAAVIAKVHT
IDWTIELLKTDTLTAGMRINWYGFFGKKVKDMVGARFGPLFSGLVGLKKPNDHGVPYSLTEEFVSVYRMHCLLPETLILR
DMNSENVDKENPAIEREIPMTELIGKKAGEKASKLGFEQLLVSMGHQSCGALTLWNYPNWMRNLVAQDIDGEDRPHLIDM
AALEIYRDRERGVPRYNEFRKNLLMSPISKWEELTDDEEAIKVLREVYEDDIEKLDLNVGLHAEKKIKGFAISETAFFIF
LLVASRRLEADRFFTTNFNEKTYTKEGLEWVNTTETLKDVIDRHFPRLTDQWMRCSSAFSVWGSDPNPKNWVPLYLRSAP
*

DNA
ATGGGTTTCTCTCCATCCTCTTCATGGTTTCTTCATCCTCAGCTTCATCATGTTGTTTCCAAGATGTCTTACTTTGATGC
TTTTTTGTTCTATATTGTGCACTTAGTGGACAAGCTAGGATTGTGGCATAGATTTCCAGTGTTATTAGGAGTGGCTTACT
TGGGGTTACGAAGACATCTACATCAACGTTACAATCTGGTACATGTCGGTCCGATCAACGGTCAGGGTTACGACACCGAT
GAGTTCTGTTATCGTACGGCTGACGGCAAGTGTAACCATCCCTCCGATAACACCATCGGCAGCCAAGGCAGCTTCATCGG
CCGGAATATGCCTCCCTCTACTTCTCAGTACGGCTTTTTTTGTCAATACTTTTTTTTCCCTGAAAATTTAGAAAAAAAAA
TTGTAGTGGCGACAAAGTTGTTAGCGAGAAAAAGATTCATAGACAATGGGGACCAATTCAACGTGATAGCTTGTTCTTGG
ATCCAGTTCATGATCCATGATTGGGTTGATCACTTAGAAGACACCCACCAGATTGAGCTTGAAGCTCCAGAAGAAGTAGC
AAGTGGATGTCCATTGAAGTCATTCAAGTTCCTCAGAACGAAGAAAGTTCCCACCGATGATCACCACAAATCTGGCGCTG
TCAACACTAGAACCCCTTGGTGGGATGGGAGTGTAATATATGGAAATGACGAGACTGGAATGAGAAGAGTTAGGGTTTTC
AAGGACGGAAAGCTAAAAATCTCTGGGGATGGCTTGTTGGAGAGGGACGAAAGAGGTGTTCCGATCTCCGGTGACATAAG
AAACAGCTGGTCAGGTTTCTCTCTGTTGCAAGCTCTCTTTGTCAAAGAACACAACTCCGTCTGTGATATGCTCAAAGAAC
GGTATCCAGATTTTGATGATGAGAAACTCTACCGGACTGCTAGACTTGTGACAGCAGCGGTTATCGCTAAGGTTCATACG
ATCGATTGGACAATAGAACTCTTAAAGACAGACACACTCACTGCTGGAATGAGGATCAACTGGTATGGGTTTTTTGGGAA
GAAAGTGAAGGACATGGTTGGAGCAAGATTTGGTCCTCTATTTAGCGGATTAGTTGGTCTGAAGAAACCGAATGATCATG
GAGTTCCTTATTCCCTTACCGAAGAGTTCGTTAGTGTTTACAGGATGCATTGTCTTCTACCAGAGACACTTATACTCCGA
GATATGAACTCTGAGAATGTAGACAAAGAAAACCCTGCAATAGAACGAGAGATACCGATGACGGAACTGATCGGGAAAAA
AGCAGGAGAAAAGGCTTCGAAACTTGGGTTTGAGCAGTTACTTGTTTCAATGGGACACCAATCTTGTGGCGCATTGACAT
TGTGGAACTACCCTAATTGGATGAGGAACCTTGTGGCTCAAGATATCGACGGAGAAGATAGACCTCACCTTATAGACATG
GCTGCCTTGGAGATTTATAGAGACCGGGAGAGAGGAGTTCCTCGGTACAACGAATTCAGAAAGAATCTGTTGATGAGTCC
GATCAGCAAATGGGAAGAGTTGACAGATGATGAAGAAGCTATCAAGGTTTTAAGAGAAGTGTACGAAGACGATATAGAGA
AGCTTGATCTAAACGTGGGGTTGCACGCAGAGAAAAAGATCAAAGGATTCGCCATTAGCGAAACTGCTTTCTTCATCTTC
CTCCTTGTCGCCTCCAGGAGGCTAGAAGCAGATAGGTTTTTCACTACGAACTTCAATGAGAAGACTTATACTAAGGAAGG
GTTAGAGTGGGTCAATACTACAGAGACTTTAAAAGATGTGATAGACCGACACTTCCCGAGGTTAACCGATCAATGGATGC
GATGTTCGAGCGCCTTCTCTGTCTGGGGCTCGGATCCTAACCCAAAGAATTGGGTTCCTTTGTACCTCCGATCCGCTCCA
TAG