Details for Arabidopsis Locus AT1G73670

Position : Chr1 ( 5`- 27700050 .. 27703440 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73670

Protein [Map View]
MGGGGNLVDGVRRWLFFQRRPSSSSSSNNHDQIQNPPTVSNPNDDEDLKKLTDPSKLRQIKVQQRNHLPMEKKGIPNAEF
FTEYGEANRYQIQEVVGKGSYGVVGSAIDTHTGERVAIKKINDVFDHISDATRILREIKLLRLLLHPDVVEIKHIMLPPS
RREFRDVYVVFELMESDLHQVIKANDDLTPEHHQFFLYQLLRGLKYVHAANVFHRDLKPKNILANADCKLKICDFGLARV
SFNDAPTAIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSVGCIFAEMLLGKPLFPGKNVVHQLDIMTDFLGTPPPEAI
SKIRNDKARRYLGNMRKKQPVPFSKKFPKADPSALRLLERLIAFDPKDRPSAEEALADPYFNGLSSKVREPSTQPISKLE
FEFERKKLTKDDIRELIYREILEYHPQMLEEYLRGGNQLSFMYPSGVDRFRRQFAHLEENQGPGGRSNALQRQHASLPRE
RVPASKNETVEERSNDIERRTTAAVASTLDSPKASQQAEGTENGGGGGYSARNLMKSSSISGSKCIGVQSKTNIEDSIVE
EQDETVAVKVASLHNS*

DNA
ATGGGTGGTGGTGGCAATCTCGTCGACGGTGTTCGTCGTTGGCTTTTCTTTCAACGTCGTCCTTCTTCTTCTTCTTCTTC
CAATAATCACGATCAGATTCAAAATCCCCCCACCGTTTCTAATCCCAACGACGACGAAGATTTGAAGAAGCTTACCGATC
CGTCTAAGCTAAGACAGATTAAGGTTCAGCAACGAAATCACTTACCTATGGAGAAGAAGGGAATACCTAATGCTGAATTC
TTCACGGAGTATGGAGAAGCAAATAGATATCAGATTCAAGAAGTAGTTGGCAAAGGAAGCTATGGAGTTGTTGGTTCTGC
TATAGATACTCACACTGGAGAAAGAGTTGCTATCAAAAAGATTAACGATGTGTTTGATCATATCTCTGATGCAACCAGGA
TTCTTAGGGAGATTAAGTTGTTACGCTTGCTTCTTCATCCAGATGTTGTTGAGATTAAACATATTATGCTTCCTCCTTCT
CGAAGAGAGTTTCGTGATGTTTATGTTGTCTTTGAGTTGATGGAATCTGATCTTCATCAGGTTATTAAAGCTAATGATGA
TTTAACTCCTGAGCATCATCAGTTTTTCTTGTATCAGCTTCTTCGTGGTTTGAAGTATGTTCATGCTGCGAATGTGTTTC
ATCGGGATTTGAAACCAAAGAACATTCTTGCTAATGCTGATTGCAAGTTGAAGATTTGTGACTTTGGTCTAGCTCGTGTA
TCTTTTAATGATGCCCCTACCGCTATTTTTTGGACTGATTATGTTGCTACTCGGTGGTACCGTGCCCCTGAACTCTGTGG
ATCATTTTTCTCAAAATATACCCCTGCGATTGATATTTGGAGCGTTGGTTGCATATTTGCTGAAATGCTATTAGGGAAGC
CGCTATTTCCTGGCAAAAATGTGGTTCACCAATTGGATATTATGACCGATTTTCTTGGCACTCCACCACCTGAAGCCATA
TCAAAGATCAGAAATGATAAGGCGAGGAGATATCTTGGCAACATGAGGAAAAAACAGCCAGTCCCATTCTCTAAAAAATT
CCCTAAAGCAGATCCTTCGGCCCTTCGCCTGTTGGAACGCCTGATTGCCTTTGATCCAAAAGATCGTCCATCTGCCGAAG
AAGCATTAGCTGATCCATACTTTAATGGTCTGTCAAGTAAAGTGCGGGAACCATCGACACAGCCGATTTCAAAGCTTGAA
TTTGAGTTTGAGAGAAAGAAATTGACAAAAGATGATATCAGAGAGTTAATTTACCGAGAGATATTAGAATATCATCCTCA
GATGCTGGAGGAATACCTTCGTGGTGGCAATCAGCTCAGCTTCATGTACCCCAGTGGGGTAGATCGATTTAGGAGGCAGT
TTGCTCATCTTGAAGAAAATCAAGGTCCAGGAGGAAGAAGTAACGCACTTCAGAGACAGCATGCTTCCTTACCAAGAGAG
CGAGTTCCAGCATCCAAGAATGAAACAGTCGAAGAAAGAAGCAACGATATCGAGAGAAGAACAACAGCTGCTGTAGCTTC
AACCTTAGACAGTCCCAAAGCTTCACAACAAGCTGAAGGTACAGAAAATGGAGGAGGAGGAGGGTATAGTGCGCGTAACC
TGATGAAAAGCTCTAGCATTAGTGGTTCTAAATGCATAGGTGTACAATCTAAAACCAACATTGAGGATTCCATAGTAGAG
GAACAAGATGAGACTGTTGCTGTGAAAGTTGCATCTCTACACAATTCTTAG