Details for Arabidopsis Locus AT1G73660

Position : Chr1 ( 5`- 27691893 .. 27697211 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73660

Protein [Map View]
MKVKEETLKNLGDGVVLRPVDHCSSIWSMKMNMKNFLKKLHISPNQSDEAEGSISTTKSNHHKSIDVSSSSSPRSHHSNS
PEIKPFSGLSNWLSSVGHRKIPSPPNSFNAKNRAATVDDTVVVNGSEHVDLGSKDPAVEEENQIQLALELSAREDPEATQ
IEAIKQFSLGSCAPENSPAELIAYRYWNYNCLGYDDKILDGFYDLYGVLNASSAERIPPLLDLQGTPVSDGVTWEAVLVN
RSGDSNLLRLEQMALDIAAKSRSVSSSGFVNSELVRKLAILVGDYMGGPVVHPESMLRAWRSLSYSLKATLGSMVLPLGS
LTIGLARHRALLFKVLCDSVGVPCRIVKGQQYTGSEDVAMNFIKADDGREYIVDLMGDPGTLIPADAAGLQIDYDESAYS
ASPGDNDSIHVASSSNGIESSYEENTEFRTGEHRSSTKSSGERNQSGGGGDLIVHPNISREDVKNQKKVEKAPFQNLSSR
PIHSFTHMRSPSWTEGVSSPAAQRMKVKDVSQYMIDAAKENPRLAQKLHDVLLESGVVAPPNLFSEVYPQQLEATVESKN
STEAKKERGKDLETTQEGRHQNGFGPVRFLPPLPRVQSKTNAHDQRDNGKVVSQSDSSHSEASSTEYARTVPAAVAAAAV
VASSMVAAAAAKSANSDSSPIELPAAAAATATAAAVVATAAAVSRQLELGSNSDGDDGSGGHEPQGSGDSNHGPNSGGER
ISDKSIGNESSKSDCDDVSDCEILWEEITVGERIGLGSYGEVYRGDWHGTEVAVKKFLDQDLTGEALEEFRSEVRIMKKL
RHPNIVLFMGAVTRPPNLSIVTEFLPRGSLYRLIHRPNNQLDERRRLRMALDAARGMNYLHSCNPMIVHRDLKSPNLLVD
KNWVVKVCDFGLSRMKHSTYLSSKSTAGTAEWMAPEVLRNEPADEKCDVYSYGVILWELFTLQQPWGKMNPMQVVGAVGF
QHRRLDIPDFVDPAIADLISKCWQTDSKLRPSFAEIMASLKRLQKPVTGSNIPRPVPSSSSLPTEHEQKD*

DNA
ATGAAAGTAAAAGAAGAAACTTTGAAGAATTTGGGAGATGGAGTGGTTTTAAGACCTGTTGATCATTGTTCTAGCATTTG
GAGTATGAAGATGAACATGAAGAACTTTCTTAAGAAACTTCATATCTCGCCCAATCAATCAGATGAAGCTGAAGGATCAA
TTTCAACAACTAAGAGCAATCATCATAAGTCTATCGATGTATCATCATCATCATCACCGAGGTCTCATCACAGCAATAGC
CCTGAAATCAAACCTTTTTCTGGTTTATCTAATTGGTTAAGTTCTGTTGGTCATAGAAAAATCCCTAGTCCTCCTAATTC
TTTCAATGCCAAGAACAGAGCCGCCACGGTTGATGACACTGTTGTTGTTAATGGGTCAGAACATGTGGATTTAGGTTCCA
AAGATCCAGCTGTTGAAGAAGAGAATCAGATACAGTTGGCTTTAGAGTTAAGTGCTAGAGAAGATCCTGAGGCTACTCAG
ATTGAGGCTATTAAGCAATTCAGTTTAGGCTCTTGTGCTCCTGAGAACTCTCCAGCTGAACTCATCGCTTATCGCTACTG
GAATTACAATTGTCTTGGCTATGATGACAAGATCTTGGATGGTTTTTATGACTTGTATGGAGTGTTGAATGCATCCTCAG
CAGAAAGAATACCTCCTTTGCTCGATCTTCAAGGGACACCTGTTTCAGACGGTGTGACATGGGAAGCTGTTCTTGTGAAC
AGAAGTGGGGATTCTAATCTGTTGAGACTTGAACAGATGGCTCTTGATATTGCTGCTAAATCAAGATCAGTTTCTTCCTC
TGGTTTTGTGAATAGTGAATTGGTAAGGAAACTGGCTATTTTAGTGGGAGATTACATGGGTGGACCAGTCGTGCACCCAG
AGAGCATGTTGAGAGCTTGGAGGAGTCTTAGCTATAGTTTGAAAGCAACTCTTGGAAGCATGGTTTTGCCACTTGGTTCT
CTGACTATTGGTTTGGCTCGTCACCGAGCCTTGTTATTCAAAGTATTGTGTGATAGTGTTGGTGTTCCTTGTCGAATAGT
CAAAGGTCAGCAATATACCGGTTCTGAAGATGTGGCAATGAACTTTATTAAGGCTGATGATGGCAGGGAGTACATTGTTG
ATCTTATGGGAGATCCCGGCACGCTTATTCCAGCTGATGCAGCTGGACTACAAATAGACTATGATGAATCTGCCTATTCC
GCTAGTCCTGGAGACAATGATTCAATTCATGTAGCTTCTTCCAGCAATGGTATTGAAAGCTCATATGAAGAGAATACAGA
GTTTCGAACAGGGGAACATCGTTCTAGTACCAAGAGTTCTGGGGAGAGAAACCAATCCGGAGGTGGAGGCGATCTCATTG
TTCATCCAAATATTTCTAGAGAAGATGTGAAAAATCAGAAGAAAGTTGAAAAGGCTCCATTTCAAAATCTGTCTAGCAGG
CCTATTCATTCTTTCACCCATATGAGATCACCTTCTTGGACTGAAGGGGTTAGCTCCCCAGCTGCACAAAGGATGAAAGT
CAAAGATGTTTCACAATATATGATTGATGCTGCTAAAGAGAATCCACGGTTAGCTCAGAAGCTTCATGATGTATTACTTG
AAAGCGGAGTTGTAGCTCCTCCCAATTTATTTTCCGAAGTCTATCCCCAGCAATTGGAGGCAACTGTTGAAAGCAAAAAC
TCGACTGAAGCCAAGAAAGAGAGAGGAAAAGATTTAGAGACAACTCAGGAAGGAAGACACCAAAACGGTTTTGGTCCAGT
GAGGTTTTTGCCTCCATTACCAAGAGTGCAATCTAAAACAAATGCACATGATCAACGTGATAATGGCAAAGTTGTAAGTC
AGTCTGATTCTTCACATTCTGAAGCATCTTCGACAGAATATGCCAGAACCGTCCCTGCTGCTGTAGCTGCAGCTGCTGTT
GTTGCATCTTCCATGGTTGCTGCTGCTGCTGCCAAGTCTGCAAACTCAGACTCCTCCCCCATAGAACTTCCTGCTGCAGC
TGCTGCCACGGCCACTGCTGCTGCAGTTGTGGCAACAGCTGCAGCCGTGTCCAGGCAACTTGAATTAGGCTCGAATAGCG
ACGGGGATGATGGTTCTGGTGGGCATGAGCCTCAAGGTAGTGGGGACTCTAATCATGGGCCAAATTCAGGAGGGGAAAGA
ATATCTGACAAATCTATTGGCAATGAAAGTTCTAAGTCAGACTGTGATGATGTATCTGACTGTGAGATTTTGTGGGAAGA
AATTACTGTGGGAGAACGTATTGGACTTGGATCTTATGGAGAAGTGTATCGGGGAGATTGGCACGGGACTGAAGTGGCTG
TCAAGAAGTTCCTTGATCAAGATTTAACAGGAGAAGCATTGGAGGAATTCAGAAGTGAGGTCCGAATCATGAAAAAGCTA
AGACATCCCAACATTGTTCTCTTCATGGGAGCTGTGACTCGCCCACCGAATCTTTCAATTGTTACAGAGTTTCTTCCTAG
AGGTAGCTTGTATAGGTTAATCCACCGGCCAAATAACCAATTAGACGAGAGGAGGCGCCTGAGAATGGCCCTTGATGCTG
CTCGTGGAATGAACTATTTGCACAGCTGTAATCCGATGATTGTCCATCGCGATCTTAAGTCCCCAAACCTTCTAGTTGAC
AAAAACTGGGTCGTGAAGGTGTGTGATTTTGGATTGTCTAGGATGAAACACAGTACATACCTCTCTTCAAAGTCAACAGC
AGGGACGGCTGAATGGATGGCTCCAGAAGTGCTAAGAAACGAACCTGCTGATGAGAAGTGCGATGTTTACAGCTACGGTG
TGATCTTATGGGAACTCTTTACGTTACAACAACCGTGGGGAAAGATGAACCCGATGCAAGTAGTTGGGGCAGTTGGGTTT
CAGCATCGACGTCTTGACATTCCCGACTTTGTAGATCCAGCAATTGCAGATCTCATCAGTAAATGCTGGCAGACGGATTC
AAAGTTAAGGCCAAGTTTTGCAGAGATAATGGCGTCTCTAAAGCGGCTACAGAAACCTGTAACAGGTTCCAACATCCCAA
GACCAGTCCCCAGTTCCTCTTCATTACCAACTGAACATGAACAAAAGGATTGA