Details for Arabidopsis Locus AT1G73655

Position : Chr1 ( 5`- 27690359 .. 27691814 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73655

Protein [Map View]
MATLFTATVPSHHRFVSPSQHPKQSLLSQSLSVTFTENPQPTAVVTLQEQQLTDWITSPVTRRFGIGAGFTWAGFLAFGV
VSEQMKKSRLDVFQEEDNTRGLEKQEEIILPNGIRYYDLQVGSGATPSSGYLVVFDVKGQVHGTEQVFVDTFGGKGKSLA
MVMDSRPYSKGLCQGIEHVLRSMKAGGKRRVIIPPSLGFGDRNVEFGQGLEIPPSATLDYIIEVDTVYCFQTIV*

DNA
ATGGCGACTCTCTTCACTGCGACGGTTCCTTCTCACCACCGTTTCGTCTCTCCATCCCAACATCCGAAACAGAGTCTTCT
ATCGCAGTCGCTAAGCGTCACATTCACGGAGAATCCACAACCAACGGCGGTGGTCACATTGCAGGAGCAGCAATTGACGG
ATTGGATTACTTCTCCGGTGACGCGACGGTTCGGAATCGGCGCCGGGTTTACCTGGGCTGGGTTTTTAGCTTTCGGTGTT
GTCTCCGAGCAGATGAAGAAGTCACGACTCGATGTGTTTCAGGAAGAGGATAACACAAGAGGTTTAGAAAAGCAAGAAGA
GATCATCTTACCAAACGGCATAAGGTACTATGATCTACAAGTTGGAAGTGGAGCTACTCCAAGCTCAGGATACTTGGTAG
TGTTTGATGTAAAGGGACAAGTACATGGCACTGAACAAGTGTTCGTGGACACATTTGGAGGCAAAGGCAAGTCACTAGCG
ATGGTAATGGACTCAAGACCGTATAGCAAGGGACTATGCCAAGGTATAGAGCATGTTCTCAGGTCAATGAAGGCTGGAGG
TAAACGTAGAGTGATAATTCCACCGTCCTTAGGATTTGGAGACAGAAATGTCGAATTTGGACAGGGTTTGGAGATTCCTC
CATCTGCAACACTTGACTATATCATCGAGGTTGATACAGTTTATTGTTTCCAAACTATTGTATGA