Details for Arabidopsis Locus AT1G73650

Position : Chr1 ( 5`- 27688123 .. 27690307 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73650

Protein [Map View]
MGTVLDSHFLALTAIVTVIYQFIFFVITALFKFDQVTDFAGSTNFVILAVLTLVLKASWHFRQIVLTLLVVVWGLRLGIF
LLMRILQWGEDRRFDEQRGNIVRLIIFWTLQAVWVWTVSLPLTLVNASDGGGSLKPADVIGWTMWVFGFLIEAAADQQKL
SFKNSPENRGKWCDVGVWKYSRHPNYFGEMLLWWGIFVAASPVLEGAEYLVIFGPLFLTLLLLFVSGIPLLEASADKKHG
NSGAYRSYKKTTSPLILFPRGVYGNLPGWFKTVFLFEFPFYSRNLPQEGRLQNSKEKEVKDD*

DNA
ATGGGAACAGTTCTCGATTCGCATTTTCTGGCTCTCACTGCTATTGTCACTGTGATTTACCAGTTCATATTCTTCGTAAT
CACGGCTCTTTTCAAATTTGATCAAGTCACTGACTTTGCTGGTAGCACAAACTTCGTTATACTTGCTGTGTTAACACTTG
TTCTCAAAGCCTCTTGGCATTTTCGACAGATAGTATTGACTTTGCTAGTTGTGGTATGGGGTCTTCGCTTGGGGATTTTC
CTTCTAATGAGGATCTTGCAATGGGGGGAAGATCGTCGCTTTGATGAACAGCGTGGAAATATAGTGAGACTAATCATTTT
CTGGACTCTTCAGGCTGTGTGGGTTTGGACGGTTAGCTTACCTTTAACACTTGTTAATGCAAGTGATGGTGGTGGATCTC
TTAAACCCGCAGATGTTATCGGTTGGACTATGTGGGTTTTCGGTTTCTTGATTGAAGCTGCAGCTGATCAACAGAAGCTA
TCATTCAAAAACTCTCCTGAAAACAGAGGAAAATGGTGTGATGTTGGAGTCTGGAAGTATTCAAGACATCCAAACTACTT
CGGTGAGATGTTACTGTGGTGGGGAATCTTTGTGGCTGCATCGCCTGTGCTTGAAGGTGCAGAGTATCTTGTCATATTCG
GACCACTCTTTCTCACTTTGCTACTTCTATTCGTCAGCGGCATACCATTACTCGAGGCATCGGCTGACAAAAAACATGGA
AACTCAGGAGCTTACAGATCCTACAAGAAGACAACAAGTCCTCTGATTCTGTTCCCAAGAGGAGTGTATGGGAACTTACC
AGGATGGTTCAAGACGGTCTTTCTCTTCGAGTTTCCATTTTACAGCCGAAATCTCCCTCAAGAGGGTAGACTCCAAAACA
GCAAAGAGAAAGAAGTAAAAGATGACTGA