Details for Arabidopsis Locus AT1G73630

Position : Chr1 ( 5`- 27684736 .. 27685453 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73630

Protein [Map View]
MANTNLESTNKSTTPSTDMELKKVFDKFDANGDGKISVSELGNVFKSMGTSYTEEELNRVLDEIDIDCDGFINQEEFATI
CRSSSSAVEIREAFDLYDQNKNGLISSSEIHKVLNRLGMTCSVEDCVRMIGHVDTDGDGNVNFEEFQKMMSSPELVKGTV
ANS*

DNA
ATGGCAAACACAAATCTTGAATCCACCAACAAATCCACAACACCATCAACGGATATGGAGCTAAAGAAAGTCTTCGACAA
GTTCGATGCCAACGGCGACGGGAAAATCTCAGTTTCAGAACTCGGAAACGTTTTCAAATCCATGGGAACGTCGTACACTG
AGGAGGAGCTAAACCGTGTATTAGACGAAATCGACATCGACTGCGACGGTTTCATCAATCAAGAAGAGTTTGCTACCATT
TGTCGATCATCTTCCTCCGCTGTAGAGATCCGTGAAGCGTTCGATCTCTACGATCAGAATAAAAACGGTTTGATTTCGTC
CTCTGAGATCCATAAAGTTCTGAATCGTCTTGGTATGACTTGCTCTGTTGAAGATTGTGTGAGAATGATTGGTCATGTTG
ATACTGATGGCGATGGAAATGTTAATTTCGAGGAGTTTCAGAAGATGATGTCGTCGCCTGAGCTCGTTAAGGGAACCGTT
GCGAACTCTTAG