Details for Arabidopsis Locus AT1G73620

Position : Chr1 ( 5`- 27681408 .. 27683130 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73620

Protein [Map View]
MTNEKCEVALPLKLKSEKPSMASSSSLFLLPLLLLVSQASASTVIFYNKCTYTVWPGIQPSSGQSLLAGGGFKLSPNRAY
TLQLPPLWSGRFWGRHGCSFDRSGRGRCATGDCGGSFLCNGAGGVPPATLAEITLGHDMDFYDVSLVDGYNLAMSIMPVK
GTGKCTYAGCVSDLNRMCPVGLQVRSRDGTQVVACKSACSAFNSPRYCCTGLFGNPQSCKPTAYSKIFKVACPKAYSYAY
DDPTSIATCSKANYVVTFCPHRGR*

DNA
ATGACCAATGAGAAATGTGAAGTTGCTCTTCCACTAAAGTTGAAATCAGAAAAACCATCAATGGCTTCTTCATCATCTCT
CTTTCTCCTCCCTCTCCTTCTTCTTGTCTCCCAAGCTTCAGCTTCAACGGTTATATTTTACAACAAGTGCACGTACACTG
TCTGGCCTGGGATCCAACCTAGCTCCGGTCAGTCATTACTCGCCGGCGGCGGATTTAAACTGTCGCCGAACAGAGCTTAC
ACTCTCCAACTTCCACCGCTCTGGTCCGGTCGCTTCTGGGGCCGCCACGGTTGCTCCTTTGACAGATCTGGCCGTGGTCG
CTGCGCCACCGGAGACTGTGGTGGTTCTTTCCTCTGTAACGGAGCTGGCGGTGTACCTCCGGCTACTCTTGCCGAGATCA
CCCTCGGTCATGACATGGACTTTTATGACGTCAGCCTCGTTGATGGATATAACTTGGCGATGTCGATAATGCCGGTGAAG
GGTACGGGAAAGTGTACCTACGCTGGTTGCGTAAGCGACCTGAACCGGATGTGCCCGGTTGGTCTACAAGTCCGTTCACG
TGACGGGACACAGGTAGTAGCCTGTAAAAGCGCATGCTCTGCGTTTAACTCACCACGCTATTGCTGTACCGGCTTGTTCG
GTAACCCACAGTCATGCAAGCCAACGGCTTACTCTAAGATCTTCAAGGTAGCTTGCCCTAAGGCTTACTCATACGCCTAC
GATGACCCAACTAGCATTGCGACATGTTCTAAAGCTAATTATGTCGTCACTTTTTGCCCTCACCGCGGCCGTTGA