Details for Arabidopsis Locus AT1G73570

Position : Chr1 ( 5`- 27650992 .. 27653942 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73570

Protein [Map View]
MRVSGQSIIAISLFTLSLYIHRVQARPFVLVLSNEDLNGGFNDNGAYESSDFDEFGESEPKSEEELDPGSWRRIFETNES
TVHASASPQYYSGLHKILSAASEGNTTLMEEAVSEIDSSASSGDPHAQSVMGFVYGIGMMRETSRSKSILHHHFAAAGGN
MQSKMALAFRYLRQNMYDKAVELYAELAETAVNSFLISKDSPMAEPVRIHIGTEENKDALRKSRGEEDEDFQILEYQAEK
GNSVAMHKIGLFYYFGLRGLRRDHAKALYWFSKAEFNGLGYLYVKGYGVDKRNYTKAREYFEMAANNEDPSGHYNLGVLY
LKGTGVKKDVRHATKYFFVAANAGQPKAFYQLAKMFHTGVGLTKNLEMATTFYKLVAERGPWSSLSRWALEAYLKGDVGK
AFILYSRMSELGYEVAQSNAAWIVDKYGERSMCMGVYGFCTDKERHDRAHSLWWRASEQGNEHAALLIGDAYYYGRGTER
DFVRAAEAYMYAKSQSNAQAMFNLGYMHEHGEGLPFDLHLAKRYYDQALQSDTAAKLPVTLALASVWVRRNYADTALVQV
LNSLPEVHQKVVEWVENGMLEEVVLDPVGANVAQPLAAPVAFPQ*

DNA
ATGAGAGTCTCAGGCCAGAGTATCATAGCCATATCTCTATTCACACTCTCACTCTACATCCATCGTGTTCAAGCCCGTCC
CTTCGTTCTCGTTCTCTCCAACGAAGATCTCAACGGAGGTTTTAATGATAACGGCGCCTACGAATCCTCCGATTTCGATG
AGTTTGGTGAATCCGAACCCAAATCCGAAGAGGAGCTTGATCCCGGTTCATGGCGTCGAATCTTCGAGACAAATGAGTCC
ACCGTCCACGCCTCTGCGTCGCCGCAGTATTACTCCGGACTCCACAAAATTCTCTCGGCTGCGAGTGAAGGAAACACTAC
ATTGATGGAGGAAGCGGTTTCAGAGATAGATTCGTCTGCCTCGTCAGGAGATCCACACGCACAATCAGTGATGGGGTTCG
TATACGGGATTGGGATGATGCGTGAGACGAGCCGAAGCAAATCGATTTTGCATCATCATTTCGCGGCTGCGGGAGGAAAT
ATGCAGTCTAAAATGGCACTTGCTTTTAGATATCTAAGACAAAATATGTATGATAAAGCTGTTGAGTTATATGCTGAACT
AGCAGAGACAGCAGTGAATAGCTTTTTGATATCCAAGGATTCTCCAATGGCTGAGCCAGTTAGAATCCACATTGGAACAG
AGGAGAATAAAGATGCACTAAGGAAGTCACGAGGGGAGGAAGATGAGGATTTTCAGATATTGGAATACCAGGCAGAGAAA
GGGAATTCTGTAGCAATGCACAAAATTGGACTGTTTTATTACTTTGGTTTGAGAGGATTAAGGCGTGATCACGCTAAGGC
GTTGTATTGGTTTTCGAAGGCGGAGTTTAATGGCCTTGGTTACTTGTATGTCAAAGGCTATGGAGTAGATAAGAGAAACT
ACACTAAGGCGAGAGAATACTTTGAGATGGCTGCTAATAATGAAGATCCTAGCGGGCATTATAACCTTGGAGTGTTGTAT
CTTAAAGGCACTGGAGTCAAGAAGGATGTGAGGCATGCAACCAAATATTTCTTTGTTGCTGCCAATGCTGGTCAACCAAA
GGCTTTTTATCAACTCGCCAAGATGTTCCATACAGGCGTTGGACTTACAAAGAACTTGGAAATGGCGACAACTTTTTATA
AGCTAGTAGCAGAAAGAGGACCATGGAGTTCTCTCTCTAGATGGGCTCTTGAAGCTTACTTGAAAGGTGATGTGGGAAAG
GCTTTTATATTGTATTCGAGAATGTCAGAGCTCGGTTATGAAGTAGCACAAAGTAATGCTGCCTGGATCGTCGATAAATA
CGGGGAAAGAAGCATGTGCATGGGAGTGTATGGGTTTTGCACAGATAAGGAGAGGCACGATCGGGCTCATTCTTTGTGGT
GGCGTGCCTCTGAACAGGGAAACGAACATGCTGCATTGCTTATTGGAGATGCATATTACTACGGTCGGGGTACAGAGAGG
GATTTCGTGCGTGCAGCAGAGGCGTACATGTATGCTAAATCTCAATCAAATGCGCAAGCAATGTTCAACCTCGGTTACAT
GCATGAGCATGGAGAAGGTCTTCCTTTTGATCTCCATCTTGCTAAACGTTACTACGACCAGGCCCTCCAGAGCGATACTG
CTGCCAAATTGCCCGTCACGCTTGCTCTTGCGAGTGTATGGGTCCGCAGAAACTATGCTGATACTGCCCTGGTGCAAGTA
CTGAATTCCTTACCAGAAGTGCATCAAAAGGTGGTGGAATGGGTAGAGAATGGGATGTTGGAAGAAGTGGTTTTGGATCC
CGTTGGTGCTAACGTGGCACAGCCCCTCGCTGCCCCAGTAGCATTTCCCCAGTAA