Details for Arabidopsis Locus AT1G73500

Position : Chr1 ( 5`- 27639091 .. 27640529 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73500

Protein [Map View]
MALVRERRQLNLRLPLPPISDRRFSTSSSSATTTTVAGCNGISACDLEKLNVLGCGNGGIVYKVRHKTTSEIYALKTVNG
DMDPIFTRQLMREMEILRRTDSPYVVKCHGIFEKPVVGEVSILMEYMDGGTLESLRGGVTEQKLAGFAKQILKGLSYLHA
LKIVHRDIKPANLLLNSKNEVKIADFGVSKILVRSLDSCNSYVGTCAYMSPERFDSESSGGSSDIYAGDIWSFGLMMLEL
LVGHFPLLPPGQRPDWATLMCAVCFGEPPRAPEGCSEEFRSFVECCLRKDSSKRWTAPQLLAHPFLREDL*

DNA
ATGGCTTTAGTACGTGAACGTCGTCAGCTAAATCTCCGTCTTCCTCTTCCTCCAATCTCCGACCGCCGCTTCTCCACCTC
TTCCTCCTCAGCCACCACCACCACCGTCGCTGGCTGTAACGGAATCTCCGCTTGTGATCTCGAGAAACTCAACGTTCTCG
GATGCGGAAACGGCGGGATTGTTTACAAAGTCCGTCATAAAACCACATCGGAGATCTACGCTTTGAAAACAGTTAACGGC
GACATGGATCCGATTTTCACAAGACAGTTGATGCGAGAGATGGAGATTCTCCGCCGTACAGATTCACCGTACGTCGTTAA
GTGTCACGGAATCTTCGAGAAACCTGTCGTCGGTGAAGTATCGATTCTAATGGAGTATATGGACGGCGGAACCCTAGAAT
CACTACGCGGCGGTGTAACGGAGCAAAAACTCGCCGGATTCGCTAAACAGATCTTAAAAGGATTAAGCTATTTACACGCT
CTTAAGATCGTTCATCGTGATATCAAACCGGCGAATCTTCTTCTCAATTCGAAAAACGAAGTTAAAATCGCTGATTTCGG
AGTTAGTAAGATCTTAGTCCGATCATTAGATTCGTGTAATTCGTATGTTGGTACTTGTGCTTATATGAGTCCGGAGAGGT
TTGATTCGGAATCTTCCGGTGGAAGCTCTGATATCTACGCCGGAGATATCTGGAGTTTCGGATTGATGATGCTTGAGCTT
CTCGTTGGTCATTTTCCTTTGCTTCCGCCGGGACAGAGACCTGATTGGGCGACGTTGATGTGCGCGGTGTGTTTTGGAGA
ACCGCCGCGAGCGCCGGAGGGATGTTCTGAAGAGTTTAGGAGCTTCGTTGAGTGTTGTCTCCGTAAAGATTCGAGTAAGC
GATGGACGGCGCCGCAGCTTCTTGCTCATCCTTTTCTCCGGGAAGATCTTTGA