Details for Arabidopsis Locus AT1G73290

Position : Chr1 ( 5`- 27556397 .. 27558773 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G73290

Protein [Map View]
MANYISSVLKSLLLLLHLVFLIQQHVDSASIVKFLPGFEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLW
LSGGPGCSSISGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSRTQQYNKPSDSGEAKRIHE
FLQKWLSKHQEFSSNPFYVAGDSYSGMVVPATVQEISKGNYQCCSPPINLQGYVLGNPITEHAIDYNYRIPFAHGMALIS
DELYESLKRVCKGEYVDPRDTECLKLVEEFSKCTKGVCQEVVIKPLCVTETPNCYIYRYLLTTYWVNDVNVRKALQINKE
SIGEWVRCYFGIPYTHDIKSSVPYHMNNSINGYRSLIYSGDHDLNVPFLATQAWVRSLNYSIIDNWRPWMIKDQIGGYTK
TYANKMTFATVRASGHTAEYKPYETYIMFHRWINGQPL*

DNA
ATGGCTAACTACATTTCCTCTGTTTTGAAGTCGCTGCTTCTGCTTCTTCATCTTGTCTTCTTGATTCAGCAGCATGTTGA
TTCTGCCTCTATCGTCAAGTTTCTTCCTGGTTTTGAAGGGTCTCTTCCCTTTGAGCTCGAAACCGGGTATATTGGTATTG
GTGAGGAAGAGGAAGTGCAACTGTTCTACTACTTCATCAAGTCTGAGAGGAATCCAAAAGAAGACCCTCTTCTTCTCTGG
CTAAGTGGAGGACCTGGCTGCTCTTCCATCTCTGGCCTTCTTTTTGAGAATGGGCCTCTGGCTATGAAGCTCGATGTTTA
CAATGGAACTCTCCCTTCTTTGGTCCCTACTACATATTCTTGGACAAAGACTTCGAGCATGATATTCTTGGATCAGCCCG
TTGGAACTGGCTTCTCCTATTCAAGAACTCAACAATATAATAAACCTAGTGATTCAGGAGAAGCCAAACGGATTCATGAG
TTTCTTCAAAAGTGGCTAAGCAAGCATCAAGAGTTTTCCTCCAACCCATTCTATGTCGCCGGTGATTCTTATTCCGGTAT
GGTTGTTCCAGCTACCGTTCAAGAAATCTCCAAAGGAAATTATCAATGCTGCAGTCCTCCGATAAATCTTCAGGGCTATG
TACTCGGTAACCCGATAACAGAACATGCAATCGATTATAACTACCGCATTCCATTTGCACATGGAATGGCATTGATCTCT
GATGAACTTTACGAGTCGTTGAAGAGAGTCTGCAAAGGAGAATATGTTGATCCACGTGACACAGAATGCTTGAAACTCGT
TGAAGAATTTAGTAAGTGTACCAAAGGAGTATGCCAAGAAGTTGTAATAAAACCATTGTGCGTAACTGAAACTCCAAATT
GCTATATTTATCGATATTTGCTAACTACGTACTGGGTCAATGACGTGAATGTACGCAAAGCTCTTCAAATCAACAAGGAG
AGTATAGGGGAATGGGTACGATGTTATTTTGGTATTCCTTACACTCATGACATTAAAAGTAGTGTACCTTACCATATGAA
TAACAGCATCAATGGTTATCGTTCTCTCATTTACAGTGGTGATCATGATTTGAATGTACCTTTCCTTGCAACTCAAGCTT
GGGTAAGATCTCTCAACTATTCCATCATTGATAACTGGAGGCCATGGATGATCAAAGATCAAATCGGGGGATACACAAAG
ACTTATGCCAATAAAATGACATTTGCAACTGTCAGAGCAAGTGGGCACACAGCAGAGTACAAGCCATATGAAACCTATAT
CATGTTCCACAGGTGGATCAATGGCCAACCTCTTTAA