Details for Arabidopsis Locus AT1G69670

Position : Chr1 ( 5`- 26202031 .. 26204442 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69670

Protein [Map View]
MSNQKKRNFQIEAFKQRVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKYGDKLYTGLVTTMTFHL
KEICKSIEEAQGGAFLELLNRKWNDHNKALQMIRDILMYMDRTYVSTTKKTHVHELGLHLWRDNVVYSSKIQTRLLNTLL
DLVHKERTGEVIDRVLMRNVIKMFMDLGESVYQDDFEKPFLEASAEFYKVESMEFIESCDCGEYLKKAEKPLVEEVERVV
NYLDAKSEAKITSVVEREMIANHVQRLVHMENSGLVNMLLNDKYEDMGRMYSLFRRVANGLVTVRDVMTLHLREMGKQLV
TDPEKSKDPVEFVQRLLDERDKYDRIINMAFNNDKTFQNALNSSFEYFVNLNTRSPEFISLFVDDKLRKGLKGVGEEDVD
LILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERNLIVKLKTECGYQFTSKLEGMFTDMKTSHDTLLGFYN
SHPELSEGPTLVVQVLTTGSWPTQPTIQCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAVFGKGQKHELNV
STFQMCVLMLFNNSDRLSYKEIEQATEIPTPDLKRCLQSMACVKGKNVLRKEPMSKEIAEEDWFVVNDRFASKFYKVKIG
TVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRRVLDHNNIIAEVTKQLQTRFLANPTEIKKRIESLIERDFLER
DNTDRKLYRYLA*

DNA
ATGAGTAATCAGAAGAAGAGAAATTTCCAGATTGAAGCGTTTAAGCAACGAGTCGTCGTTGATCCAAAATACGCCGATAA
AACTTGGAAGATCCTTGAACATGCGATTCATGAGATTTACAATCACAACGCTAGTGGTCTCAGTTTCGAAGAGCTTTACA
GAAACGCATACAACATGGTTCTACATAAGTATGGTGATAAGCTTTATACTGGACTTGTTACCACTATGACATTTCATCTC
AAAGAGATATGTAAGTCTATTGAAGAAGCTCAAGGAGGAGCATTTTTAGAATTGCTTAATAGGAAATGGAATGATCATAA
CAAAGCGTTGCAAATGATTAGGGATATTCTCATGTATATGGATCGTACTTACGTTTCTACTACTAAGAAAACTCATGTTC
ATGAGCTTGGACTTCATCTCTGGAGAGATAATGTTGTGTATTCGAGTAAGATTCAGACTAGGCTATTGAATACGCTTCTT
GATTTAGTTCATAAGGAACGGACTGGTGAAGTTATAGATAGGGTGTTGATGAGGAATGTGATTAAGATGTTTATGGATTT
AGGTGAATCTGTTTATCAAGATGATTTTGAGAAGCCGTTTTTGGAAGCTTCTGCTGAGTTTTATAAGGTTGAGTCAATGG
AGTTTATTGAGTCTTGTGATTGTGGTGAGTATTTGAAGAAAGCTGAGAAGCCTTTAGTGGAAGAAGTCGAAAGGGTTGTG
AATTATTTGGATGCTAAGAGCGAAGCGAAGATTACTAGTGTGGTTGAAAGAGAGATGATTGCTAACCATGTGCAGAGACT
AGTTCATATGGAGAATTCAGGTTTGGTTAATATGCTTTTGAATGATAAGTATGAGGATATGGGTAGAATGTATAGTTTGT
TCCGTAGGGTTGCTAATGGTCTTGTAACGGTTAGAGATGTTATGACTTTGCATCTTAGGGAAATGGGAAAACAGTTGGTT
ACTGATCCAGAGAAATCAAAGGATCCGGTTGAATTTGTGCAGCGTCTATTGGATGAGCGGGATAAGTATGACAGAATTAT
CAACATGGCATTTAACAACGATAAGACGTTCCAGAATGCGCTAAATTCTTCGTTTGAGTATTTCGTCAACTTGAACACAC
GTTCTCCTGAGTTTATCTCCCTGTTTGTTGATGATAAGCTACGAAAAGGACTAAAAGGTGTGGGAGAGGAGGATGTCGAT
CTTATTCTTGATAAGGTGATGATGTTGTTTCGCTACTTACAGGAGAAAGACGTTTTTGAGAAATATTACAAACAGCATCT
GGCGAAAAGGCTTTTATCTGGAAAAACTGTGTCGGATGATGCAGAGAGGAATCTGATAGTGAAACTGAAGACGGAATGTG
GGTATCAATTCACTTCGAAACTTGAAGGTATGTTCACTGACATGAAGACCTCACACGACACGCTGCTAGGATTTTATAAT
AGCCATCCCGAGCTTTCAGAAGGACCTACACTTGTTGTTCAGGTTCTCACAACCGGTTCTTGGCCCACACAGCCAACCAT
ACAATGTAACCTACCTGCAGAAGTTTCTGTTCTGTGTGAGAAGTTCAGGTCATATTACCTCGGGACTCACACCGGTAGGA
GATTGTCTTGGCAAACGAATATGGGAACAGCAGATATCAAAGCAGTGTTTGGAAAGGGTCAGAAGCATGAACTAAACGTT
TCGACTTTCCAAATGTGTGTCCTTATGTTGTTCAACAACTCTGATCGACTAAGCTACAAAGAGATCGAACAGGCAACTGA
AATCCCCACCCCAGACCTAAAGCGTTGCTTGCAGTCAATGGCGTGTGTAAAAGGTAAAAACGTGCTAAGAAAAGAACCAA
TGAGCAAGGAGATAGCAGAGGAGGACTGGTTTGTTGTGAACGACAGGTTCGCAAGCAAGTTCTACAAAGTGAAGATAGGA
ACTGTGGTGGCACAAAAGGAGACAGAACCAGAGAAGCAAGAGACAAGACAGAGAGTAGAAGAAGACAGAAAACCTCAGAT
CGAAGCAGCCATCGTGAGGATAATGAAGTCTAGACGAGTGTTGGATCACAACAACATAATCGCAGAGGTCACCAAACAGT
TGCAGACGCGGTTCTTGGCAAACCCAACAGAGATAAAGAAGAGAATTGAATCACTCATTGAGCGTGATTTCTTGGAGAGG
GATAATACAGACCGGAAACTTTACCGCTATCTAGCGTAA