Details for Arabidopsis Locus AT1G69560

Position : Chr1 ( 5`- 26157755 .. 26159094 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69560

Protein [Map View]
MEMVHADVASLSITPCFPSSLSSSSHHHYNQQQHCIMSEDQHHSMDQTTSSDYFSLNIDNAQHLRSYYTSHREEDMNPNL
SDYSNCNKKDTTVYRSCGHSSKASVSRGHWRPAEDTKLKELVAVYGPQNWNLIAEKLQGRSGKSCRLRWFNQLDPRINRR
AFTEEEEERLMQAHRLYGNKWAMIARLFPGRTDNSVKNHWHVIMARKFREQSSSYRRRKTMVSLKPLINPNPHIFNDFDP
TRLALTHLASSDHKQLMLPVPCFPGYDHENESPLMVDMFETQMMVGDYIAWTQEATTFDFLNQTGKSEIFERINEEKKPP
FFDFLGLGTV*

DNA
ATGGAGATGGTGCATGCTGACGTGGCGTCTCTCTCCATAACACCTTGCTTCCCGTCTTCTTTGTCTTCGTCCTCACATCA
TCACTATAACCAACAACAACATTGTATCATGTCGGAAGATCAACACCATTCGATGGATCAGACCACTTCATCGGACTACT
TCTCTTTAAATATCGACAATGCTCAACATCTCCGTAGCTACTACACAAGTCATAGAGAAGAAGACATGAACCCTAATCTA
AGTGATTACAGTAATTGCAACAAGAAAGACACAACAGTCTATAGAAGCTGTGGACACTCGTCAAAAGCTTCGGTGTCTAG
AGGACATTGGAGACCAGCTGAAGATACTAAGCTCAAAGAACTAGTCGCCGTCTACGGTCCACAAAACTGGAACCTCATAG
CTGAGAAGCTCCAAGGAAGATCCGGGAAAAGCTGTAGGCTTCGATGGTTTAACCAACTAGACCCAAGGATAAATAGAAGA
GCCTTCACTGAGGAAGAAGAAGAGAGGCTAATGCAAGCTCATAGGCTTTATGGTAACAAATGGGCGATGATAGCGAGGCT
TTTCCCTGGTAGGACTGATAATTCTGTGAAGAACCATTGGCATGTTATAATGGCTCGCAAGTTTAGGGAACAATCTTCTT
CTTACCGTAGGAGGAAGACGATGGTTTCTCTTAAGCCACTCATTAACCCTAATCCTCACATTTTCAATGATTTTGACCCT
ACCCGGTTAGCTTTGACCCACCTTGCTAGTAGTGACCATAAGCAGCTTATGTTACCAGTTCCTTGCTTCCCAGGTTATGA
TCATGAAAATGAGAGTCCATTAATGGTGGATATGTTCGAAACCCAAATGATGGTTGGCGATTACATTGCATGGACACAAG
AGGCAACTACATTCGATTTCTTAAACCAAACCGGGAAGAGTGAGATATTTGAAAGAATCAATGAGGAGAAGAAACCACCA
TTTTTCGATTTTCTTGGGTTGGGGACGGTGTGA