Details for Arabidopsis Locus AT1G69530

Position : Chr1 ( 5`- 26141836 .. 26143500 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69530

Protein [Map View]
MALVTFLFIATLGAMTSHVNGYAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACF
EIRCQNDGKWCLPGSIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPVAYRRVPCVRRGGIRF
TINGHSYFNLVLITNVGGAGDVHSAMVKGSRTGWQAMSRNWGQNWQSNSYLNGQSLSFKVTTSDGQTIVSNNVANAGWSF
GQTFTVEAVRERGMIVIWSFLSIEVNLKRSGASSA*

DNA
ATGGCTCTTGTCACCTTCTTGTTTATTGCTACCCTTGGAGCAATGACGTCACATGTCAATGGTTACGCCGGAGGAGGTTG
GGTCAACGCACACGCCACATTCTACGGTGGTGGTGATGCTTCCGGCACAATGGGAGGTGCTTGTGGATACGGAAACCTAT
ATAGCCAAGGCTATGGAACCAACACGGCGGCGCTAAGCACGGCTCTATTCAATAATGGTCTAAGTTGTGGTGCTTGCTTC
GAGATAAGATGTCAAAACGATGGAAAATGGTGTCTTCCTGGCTCAATTGTCGTCACAGCCACAAACTTTTGCCCTCCTAA
CAACGCCTTACCGAACAACGCAGGAGGTTGGTGTAACCCTCCTCAGCAGCATTTTGATCTCTCTCAGCCCGTATTTCAAC
GCATCGCTCAATACAGAGCCGGCATTGTCCCCGTCGCTTACCGAAGAGTGCCGTGCGTGAGAAGAGGAGGAATAAGGTTT
ACGATAAACGGACACTCTTACTTCAACCTAGTTCTGATCACTAACGTCGGAGGAGCCGGAGATGTTCACTCAGCGATGGT
TAAAGGTTCAAGAACTGGATGGCAAGCGATGTCAAGAAACTGGGGACAGAACTGGCAGAGTAACTCTTACCTTAACGGAC
AATCTCTCTCATTCAAAGTTACAACAAGCGATGGCCAAACCATTGTCTCTAACAACGTTGCTAACGCAGGCTGGTCTTTC
GGCCAGACCTTCACAGTAGAAGCAGTTAGAGAGAGGGGCATGATAGTAATTTGGTCCTTTCTTTCAATTGAGGTTAACCT
AAAAAGAAGTGGTGCTTCGAGTGCTTGA