Details for Arabidopsis Locus AT1G69485

Position : Chr1 ( 5`- 26118229 .. 26119576 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69485

Protein [Map View]
MELMAVPKKKISKHKRGIRNGPKAFKPTPVIIRCRSCGRVKLPHFYCCSGERAIPDEQSNSNN*

DNA
ATGGAGCTAATGGCTGTGCCCAAGAAGAAGATTTCTAAACACAAGAGAGGGATAAGAAATGGACCAAAGGCCTTTAAACC
TACTCCTGTGATCATCCGTTGCAGGAGTTGTGGGCGAGTTAAGCTGCCACATTTCTACTGCTGCAGTGGTGAGCGGGCAA
TACCTGATGAACAAAGCAATTCAAACAACTGA