Details for Arabidopsis Locus AT1G69460

Position : Chr1 ( 5`- 26111809 .. 26113243 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69460

Protein [Map View]
MFLQSQKLWTMLLILAIWSPISHSLHFDLHSGRTKCIAEDIKSNSMTVGKYNIDNPHEGQALPQTHKISVKVTSNSGNNY
HHAEQVDSGQFAFSAVEAGDYMACFTAVDHKPEVSLSIDFEWKTGVQSKSWANVAKKSQVEVMEFEVKSLLDTVNSIHEE
MYYLRDREEEMQDLNRSTNTKMAWLSVLSFFVCIGVAGMQFLHLKTFFEKKKVI*

DNA
ATGTTTCTCCAATCGCAAAAACTATGGACGATGCTTCTAATTCTAGCGATTTGGTCACCAATTTCACACTCGCTTCACTT
CGATCTACACTCAGGTCGCACAAAGTGTATCGCCGAAGACATCAAAAGCAATTCAATGACTGTTGGTAAATACAACATCG
ATAATCCTCACGAAGGTCAAGCTTTACCACAAACTCACAAAATTTCCGTCAAGGTGACGTCTAATTCCGGTAACAATTAC
CATCACGCGGAACAAGTAGATTCAGGACAATTCGCATTCTCGGCTGTTGAAGCAGGTGATTACATGGCTTGTTTCACTGC
TGTTGATCATAAGCCTGAGGTTTCGTTGAGTATTGACTTTGAGTGGAAGACTGGTGTTCAATCTAAAAGCTGGGCTAATG
TTGCTAAGAAGAGTCAAGTCGAAGTTATGGAATTTGAAGTAAAGAGTCTTCTTGATACTGTTAACTCGATTCATGAAGAG
ATGTATTATCTTAGAGATAGGGAAGAAGAGATGCAAGACTTGAACCGGTCCACTAACACAAAAATGGCGTGGTTGAGTGT
TCTCTCGTTTTTCGTCTGCATAGGAGTTGCAGGGATGCAGTTTTTGCACTTGAAGACGTTTTTCGAGAAGAAGAAGGTTA
TCTGA