Details for Arabidopsis Locus AT1G69430

Position : Chr1 ( 5`- 26097787 .. 26099388 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69430

Protein [Map View]
MEMGLSGMMNHGGSNSKLRKFEIESSSSSPSSSSDHKFHSMNALEILRETVRILRYNLGAFMLIALLLICPVSAILLPNL
LVDQSVVNSLTVRLLLVSKSSGLPLLPFVRNSCQKFSETAVSSAMCFPLFITLSLLSRAAVVYSVDCTYSRKKVVVTKFV
VIMQRLWKRLVITYLWICTVIVVCLTSFCVFLVAVCSSFYVLGFSPDFNAYGAILVGLVFSVVFANAIIICNTTIVISIL
EDVSGPGALVRASDLIKGQTQVGLLIFLGSTIGLTFVEGLFEHRVKSLSYGDGSSRLWEGPLLVVMYSFVVLIDTMMSAV
FYFSCRSYSMEAVEALEASGEIVSQDLSLL*

DNA
ATGGAAATGGGTTTATCTGGGATGATGAATCATGGAGGATCAAATTCAAAATTACGGAAATTTGAGATAGAATCATCATC
ATCATCACCATCATCATCCTCTGATCATAAGTTTCATTCGATGAATGCTCTTGAGATCTTGAGAGAAACCGTTAGAATTC
TCCGGTATAATCTTGGTGCTTTCATGTTAATCGCTCTTCTTTTGATCTGTCCTGTTTCCGCTATTCTATTACCAAACCTT
TTAGTTGATCAATCAGTTGTTAATTCACTTACAGTGAGGCTTCTCTTAGTTTCCAAATCAAGTGGTCTTCCTTTATTGCC
TTTTGTTAGAAACTCTTGTCAGAAATTCTCTGAGACAGCTGTTTCTTCTGCAATGTGTTTCCCTTTGTTCATCACTTTGT
CACTCTTGTCTAGAGCTGCTGTGGTTTACTCTGTTGATTGCACTTATTCGAGGAAGAAAGTTGTGGTGACTAAGTTTGTG
GTGATAATGCAGAGACTATGGAAACGTCTTGTGATCACTTACTTGTGGATTTGTACTGTGATTGTTGTTTGTCTCACTTC
CTTCTGCGTGTTTCTCGTCGCGGTTTGTAGCTCTTTCTATGTTCTCGGATTCTCTCCTGATTTTAATGCCTATGGAGCTA
TCTTAGTTGGTTTGGTGTTCTCAGTAGTGTTTGCAAATGCTATCATTATCTGTAACACCACGATCGTGATCTCGATTCTT
GAAGATGTGTCGGGGCCAGGAGCGTTGGTTAGAGCGAGTGATTTGATCAAAGGACAGACTCAGGTTGGTTTGTTGATATT
TCTAGGATCAACAATAGGGTTGACGTTTGTGGAAGGATTGTTTGAGCATAGAGTGAAGAGTTTGAGTTATGGAGATGGTT
CTTCGAGGTTATGGGAAGGTCCACTACTTGTGGTGATGTATTCATTTGTGGTGCTTATTGATACAATGATGAGTGCAGTG
TTCTATTTTAGTTGCCGGTCTTATAGTATGGAAGCTGTTGAAGCTTTGGAAGCTTCTGGAGAGATTGTGTCCCAAGATTT
GTCCCTGCTTTAA