Details for Arabidopsis Locus AT1G69360

Position : Chr1 ( 5`- 26072284 .. 26076254 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69360

Protein [Map View]
MGETVHCGSFLSSMRDLSEDISNTCSYSMYCGGDKTLPYGQYQNGFSARPPTDSYERDFLKQTMLEHEAVFKNQVYELHR
LYRTQKSLMAEVKGKNFVDHLNNNEPTPGSGIKRGFLFGNSICGEGSTSQDCNVGKDNKVLEVRPVKVRRTMIDLQLPAD
EYLHTEGDNTTCPPYEQSKEVGENIFFESHRNDSSGSSLLMKNSNGFTDLNEPVQCQDSVPVSSSSRDLYSLYGANISHV
QGQWVEKNTSQNGWMVLEAGNGKSTPRDKLCLPSHSVQVLSNSAFQPLGYPSTDHSKLSGERASFKCEVRQRNPEVSYDS
YVESSVASNVPSLNHGYRPESVRPWSHWISSWENRSSSSVQKPLPLQANPFLTFNTQVRADSSAEMRSRDSNGLNQGFSS
FSEESAFNFPSVNFNHLNNGPKGAVTNGSLCESVMHQSLKNLQGPKKQECSSGLPWIKPKPLNKNGKTNGGLDLNASANH
QFMDERDMGDSSNYVHPQNGLRSVTCSNDANLRHVEMANSQSRRKILGFPISQKLSICEEHPSLITSSVCISNEPKKVNN
LVKINLDINLPCEASVSEGVVVDKEEGNKAATHRQHIDLNFCASEDEDSGFCSNPRVETKATTLINVEAPLTLESEEEGG
KFPEKRDEAGDSVDELIEAAAEAIVTISLSYHCRNTDEAASSSTDAVDKEPLSWFVNTIASCGNDLESKIDACLEARDCE
GCREECSSGEFDYFEAMTLNLTQTKEEDYMPKPLIPEYLKFDGTGSMGITSNRPRRGQARRGRPKRDFQRDILPGLASLS
RLEVTEDLQMFGGLMKATGYNWNSGMARRSSNRGRKRLVSNIDRAPVCSSLAQPMNNSSVQMVGLEDRSLTGWGNATRRP
RRHRCPAGTPPTVLLT*

DNA
ATGGGAGAAACAGTTCATTGTGGAAGCTTCTTGTCCTCAATGAGGGATCTAAGTGAAGATATTTCCAATACTTGTAGCTA
TTCAATGTATTGTGGAGGTGATAAAACTTTGCCTTATGGGCAGTATCAGAATGGTTTCTCGGCGAGACCTCCAACGGATT
CTTACGAGAGAGATTTTTTGAAACAAACAATGCTTGAACATGAAGCTGTATTTAAGAATCAGGTTTATGAGCTTCACCGT
TTGTATAGAACACAGAAGAGTTTGATGGCTGAAGTTAAGGGAAAGAACTTTGTTGATCACTTGAACAACAATGAGCCTAC
ACCGGGAAGTGGGATTAAACGAGGATTTCTTTTCGGAAACTCGATATGTGGCGAAGGAAGCACCTCTCAAGATTGCAATG
TTGGCAAGGACAACAAGGTGTTAGAGGTTAGACCTGTCAAGGTTAGGAGAACAATGATTGATCTTCAACTTCCCGCAGAT
GAGTATCTCCATACAGAGGGTGATAATACGACTTGTCCTCCTTATGAGCAGTCAAAAGAAGTTGGTGAAAACATCTTCTT
TGAATCTCATCGGAACGATTCTTCTGGATCTTCTTTGCTTATGAAGAACTCAAATGGATTTACTGACTTGAACGAGCCAG
TCCAATGCCAAGATTCAGTACCTGTTTCTTCTTCTTCCAGGGACTTATATTCTCTTTATGGAGCAAACATTTCACACGTG
CAAGGCCAGTGGGTGGAAAAAAATACTAGTCAAAATGGATGGATGGTTCTAGAAGCAGGGAACGGAAAAAGCACTCCAAG
AGACAAGTTATGCCTGCCTTCCCATTCGGTACAAGTTCTTTCTAACAGTGCATTTCAACCTCTGGGATACCCTTCAACTG
ACCACAGCAAGTTATCGGGCGAAAGAGCATCTTTCAAATGTGAAGTTCGTCAAAGGAATCCTGAGGTTTCGTATGATAGC
TATGTGGAATCAAGTGTGGCATCAAATGTTCCAAGCTTGAATCATGGATATCGCCCGGAATCTGTCAGACCTTGGAGCCA
TTGGATTTCATCATGGGAGAACCGAAGTAGCAGCTCAGTTCAGAAACCTTTGCCACTTCAAGCGAATCCATTCTTGACTT
TTAATACTCAAGTACGAGCAGACTCAAGTGCAGAGATGAGAAGCCGTGATTCTAACGGGCTTAACCAAGGATTCTCTTCA
TTCTCGGAGGAAAGTGCCTTTAATTTTCCATCAGTAAACTTTAACCATCTTAACAATGGCCCAAAAGGGGCAGTTACTAA
TGGTTCTTTGTGTGAGAGTGTGATGCATCAGAGTCTTAAAAACCTTCAAGGACCAAAAAAGCAGGAGTGCTCTTCTGGTT
TGCCCTGGATAAAACCTAAGCCCCTTAACAAAAATGGAAAAACCAATGGTGGTTTGGATTTGAATGCTTCTGCAAATCAT
CAATTCATGGATGAACGTGATATGGGTGACAGCTCAAATTATGTACATCCTCAGAATGGTTTGAGGTCTGTTACATGTTC
TAATGACGCCAACTTGAGACATGTTGAAATGGCCAATTCACAGAGTCGTAGAAAGATTCTTGGTTTTCCTATCTCTCAGA
AGCTTTCTATTTGCGAGGAGCACCCTTCCCTTATAACTTCTTCTGTGTGTATCTCTAATGAACCCAAGAAAGTAAACAAC
TTGGTGAAGATAAACCTCGATATCAACCTGCCATGTGAAGCCTCGGTTTCTGAAGGAGTTGTTGTGGACAAGGAAGAAGG
TAATAAAGCTGCCACTCACAGGCAGCACATTGACTTGAATTTCTGTGCTAGCGAGGATGAAGATTCCGGCTTCTGTTCTA
ATCCAAGAGTGGAAACAAAAGCAACTACTTTGATAAATGTGGAAGCTCCCTTGACGCTTGAGAGTGAAGAAGAAGGAGGG
AAATTTCCAGAGAAGAGAGATGAAGCTGGAGACTCTGTGGATGAACTCATCGAGGCAGCAGCAGAAGCTATAGTCACTAT
CTCACTGTCTTATCATTGCCGCAATACTGATGAAGCTGCTTCCTCTTCGACTGATGCAGTTGACAAGGAGCCGCTCTCTT
GGTTTGTGAACACAATAGCTTCTTGTGGCAATGATTTAGAGAGCAAAATTGATGCTTGTTTGGAAGCCAGAGACTGTGAA
GGCTGCCGTGAAGAATGTTCTTCAGGTGAGTTTGATTATTTTGAGGCAATGACCCTGAACTTAACACAGACCAAAGAAGA
AGACTACATGCCAAAGCCTTTAATCCCTGAATATCTGAAATTTGATGGGACGGGTTCTATGGGTATCACAAGTAATAGGC
CAAGAAGAGGACAAGCGAGACGAGGAAGACCAAAGCGGGATTTCCAAAGGGATATTCTCCCTGGGCTAGCTTCTCTGTCT
AGGCTCGAAGTAACCGAAGATCTTCAGATGTTTGGGGGACTTATGAAAGCCACAGGCTACAACTGGAACTCAGGAATGGC
CCGAAGGAGCTCAAACCGAGGAAGAAAACGACTGGTCAGCAACATTGACAGAGCTCCGGTTTGCTCCTCTTTGGCACAGC
CAATGAATAACAGTAGTGTACAAATGGTGGGACTGGAAGATAGGAGCCTTACAGGGTGGGGAAATGCAACCAGAAGACCA
AGGCGACATAGGTGCCCTGCAGGTACTCCCCCAACAGTGCTATTAACATAA