Details for Arabidopsis Locus AT1G69320

Position : Chr1 ( 5`- 26061862 .. 26062514 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69320

Protein [Map View]
MKTNRNRPINILIVFFLLTTARAATRNWTNRTHRTVPKVQHAYYAYPHRSCESFSRPYARSMCIELERIHRSSRQPLFSP
PPPPTEIDQRYGVEKRLVPSGPNPLHN*

DNA
ATGAAGACTAACCGGAACCGTCCGATCAACATCCTCATCGTCTTCTTCCTTCTTACGACCGCAAGAGCAGCAACAAGAAA
CTGGACCAACCGAACTCACCGAACCGTCCCTAAGGTTCAACACGCGTACTACGCATATCCTCACCGTTCATGCGAATCTT
TCTCTCGTCCATACGCACGCTCTATGTGCATTGAGCTCGAAAGAATCCACAGAAGCAGTCGACAACCGCTTTTCTCTCCT
CCGCCTCCTCCGACGGAGATTGATCAAAGGTACGGCGTCGAGAAAAGACTTGTTCCCTCCGGTCCAAACCCACTTCACAA
CTGA