Details for Arabidopsis Locus AT1G69295

Position : Chr1 ( 5`- 26050197 .. 26052567 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G69295

Protein [Map View]
MSVLLPLCLIISMFTYSNAAYCLCKEGNEQVLQKAIDYACGNGADCTQIQPTGACYQPNTVKNHCDVAVNSYYQKKASSG
ATCDFNGAASPSTTPPSTASNCLTGSSSSGTPTTGTPTTGTPTSGTPTTGTPTTGTPTTGTPTSGTPTSGFPNTGTPNTG
TNTGMPNSNGMPTSSSSSVFPGTTLGPTGSGGLGDPNAGEKLSVRTNTVVFLLTGVAAMLVI*

DNA
ATGTCGGTTTTACTTCCTCTCTGTCTGATTATCTCCATGTTCACCTATTCAAACGCAGCGTATTGTCTTTGCAAAGAGGG
GAACGAGCAAGTGCTTCAGAAGGCAATAGACTACGCTTGTGGAAATGGAGCTGACTGTACCCAGATCCAACCCACCGGAG
CTTGTTACCAACCTAACACCGTCAAAAACCACTGTGACGTCGCCGTCAACAGTTACTACCAGAAAAAAGCTTCTTCCGGT
GCCACCTGTGACTTTAACGGCGCCGCCTCCCCCTCTACTACCCCTCCGTCAACTGCTTCAAACTGTTTAACTGGTTCAAG
CTCTAGTGGCACTCCTACCACAGGAACACCAACTACTGGGACACCAACCAGTGGGACCCCGACTACCGGAACTCCGACCA
CCGGAACCCCCACCACTGGAACTCCAACCAGTGGGACTCCAACTAGTGGCTTCCCAAATACCGGGACTCCAAACACAGGG
ACTAACACTGGGATGCCAAATTCCAACGGGATGCCAACTTCATCGTCATCTTCGGTGTTCCCGGGGACTACTCTTGGCCC
GACTGGGAGCGGGGGACTAGGCGATCCAAATGCTGGAGAGAAGCTGTCTGTTCGAACTAACACAGTGGTCTTCTTATTAA
CCGGTGTAGCAGCAATGCTTGTCATATGA