Details for Arabidopsis Locus AT1G55325

Position : Chr1 ( 5`- 20637380 .. 20648434 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55325

Protein [Map View]
MWTNVFRIGGLHNVSWFQFLPSETELNPGFDRSSRAEQNEVATYLVLSSHLRLQKEGFLTTWTNSFVGPWDPSQGLYNPD
EKIKLWLFLPGRHSSISDKAQAAVSKLRVVASGIWVAPGDSEEISVAFSQSLRNCIERALSGISYMRFGDVFSKFSPQSE
EYLRRGQPTVEFIFAATEEAVFVHVIISAKNVRTLSSGDAERMLRSSLKNSSYRLPVIVSPHGMRGSLTGFCPNDLVKQV
YFSSGNLKTSTGYVGLPSHIGRGSRLINGNHCYVEVTLGCCQNRNDNTSQANSTFAVNLPHNQCPEPSVGSKDHRKGQSD
LSSVCEKKFIYPAEAVLVPILQSAFAKFSLKRFWLQNWIGPSLAGSSLFMHWAGDFDCLGASENKSDGFYEKNGYNSSGS
SRNSSISSTSSASSGSGWRMTSRTGDLDADADSLTCRQSGLTCNDDRLKMGSKRPRTGMAESFGQVGIENDQIGWDWDAD
DDDDDREVGMDIKALLSEFGDFGDFFENDALPFGEPPGTAESHVLVFPPDSADVGSSPVDMMDVSDQIVLPVGFSSFESF
NPVPPIIDECLIKSQEVLHSSITSVPSNQMSISSTGEFDHLLKAEAMMTFAPEYGAVEAPMSEISSTFFKSPYLPKSHKV
ESSNSRTSNYVYGATPPTTDSDGAGDMILFGSKSCIGNNAGRTLYHSREHYTQVEGRKGRHDKLPTVISDNSSTKEGVSQ
SIHSKHSAANAVKVVQGKKTDGISAVVSTLLSSKTLLATDVGSVMFQAFMCRMRHIITSSKHSSPVSLTRLSGNFFLNQL
SNEPSTLTDNISARNEIYKKDIPTRIAGDFDGGMLDSHMSAPVGVWRTVSVPKTAKPASSPNIEAGSSLPHSSFSEDSLL
SYGQRQPLQDLLDGIALLVQQATSFVDLALDSDCGDGPYGWLALEELWRRELSCGPSAGHAGCGGTLASCHSLDIAGVKL
VDPLSAEVFPSSVITLLQSDIKTALKSAFGQSDGPLSVTDWCKGRNQSGDGGSISEGFTAESALSEVSNAIDGGKGDETA
QSQDIYSSELLRPTLFVLPSPAILVGYQDDWLKISTNSLTHWEKAPFEPYALPKSINYAVVCPDIDPLTCAATDFFQQLG
TVYETCRLGTHLPQSLGNQMEKDVGRLSSSGFVLLDCPQSMKIESNNTSLLGSLSDYFLSLSNGWNVNSYLKSLSKALKG
LKLGSGLYTNQKEGSGSPCVVVYIVCPFPDPSAVLRTIVESSIALGSVIQSDRDRRSILNSQVARAFSSSTAVDEASISH
IPVLSGFSVPKLVLQVVSVDSIFRITSPSFNELVILKDTAFSVYNKARRISRGMPNDAFFSSSLPSRSSSALTPMNSISG
IWKDCGGSRMTGSTHPRDGEIDVSLRTSGWDTSTSWQIPRSGGLSCDPNRNGDFYLNDEIFYLFEPLFILSEPGSVERGV
SPTFTSLGSESSKPIPEDGGRGSGPGMNSMEGITSGSSSQGDVSQLEGKAIPSLHCCYGWTEDWRWLVSIWTDARGELLD
THIFPFGGISSRQDTKGLQCLFVQVLQQGCQILQACSSPDNGSFKPRDFVITRIGNFFELEYQEWQKAIYSAGGPEIKKW
PIQLRRSAPSGIATNSNGSSLQQQDLSLIQERASSTSTLYSSHSKQSTFVKGSMGQSAGRKQIMGGQTISGTPRGLFQWV
HSISFASISLDHSLHFVLPAELVSAGGGQSSTGMSSVNYIEGFTPVKSLGSTAFSYMMIPSPNMRFLHPSPLQLPTCLTA
ESPPLAHLLHSKGYAIPLSTGFVVSKAVPSMRKDSRINVKEEWPSVLSVSLIDYYGGYDNAHDKILQGIVKQGGGTKETR
DFEVESHLILESIAAELHALSWMTVSPAYLDRRTALPFHCDMVLRLRRLLHFADKEVSRIPDKTGLKVLTTDSGSQSLSM
SLPRDHLDGICFQHTDCNFLRCCSPFLSGHIRRDGEQVNGQIKTAAIYYGVSLFPGKIDNLNAMVWSHSCCRPLSSMHHM
A*

DNA
ATGTGGACTAATGTTTTCAGAATTGGTGGTCTACATAATGTTTCTTGGTTTCAGTTTCTTCCAAGTGAAACTGAGCTGAA
TCCTGGCTTTGATAGAAGTTCAAGAGCTGAGCAGAATGAAGTTGCAACATATCTTGTACTTTCCTCTCATCTACGGTTGC
AGAAGGAAGGGTTTCTTACCACTTGGACCAATTCTTTTGTTGGACCTTGGGATCCATCTCAAGGTTTATACAACCCTGAT
GAAAAGATTAAGCTTTGGCTTTTTCTACCTGGGCGTCATTCATCAATATCTGATAAAGCTCAGGCTGCTGTGTCAAAGCT
TAGAGTTGTTGCGTCAGGAATTTGGGTAGCACCTGGGGACTCTGAAGAGATATCAGTTGCCTTTTCACAGTCTTTACGTA
ATTGCATCGAAAGAGCATTATCTGGAATTTCCTACATGAGATTTGGAGATGTGTTTTCAAAATTCAGCCCTCAAAGCGAA
GAATATTTGAGGAGGGGACAGCCTACTGTTGAATTCATCTTTGCTGCTACCGAAGAGGCAGTTTTTGTCCATGTCATTAT
ATCTGCCAAGAATGTCCGCACACTTTCAAGTGGCGATGCTGAAAGAATGTTAAGGAGTTCTTTGAAAAACTCCAGTTATA
GGCTTCCAGTTATTGTTTCTCCTCATGGAATGCGGGGCAGCCTTACTGGATTCTGTCCCAATGACCTTGTCAAGCAAGTC
TACTTCAGTTCTGGAAACTTAAAAACTTCGACTGGATATGTTGGTCTCCCTTCTCATATTGGTCGTGGGTCCCGTCTGAT
AAATGGCAATCATTGCTACGTGGAAGTTACACTTGGTTGCTGCCAAAATAGAAATGACAACACAAGTCAAGCTAATTCGA
CCTTTGCAGTTAACTTGCCCCATAACCAGTGTCCTGAACCTTCAGTTGGGAGTAAAGATCACCGTAAAGGACAATCAGAT
CTTTCATCAGTTTGTGAAAAAAAGTTCATCTATCCAGCTGAGGCAGTGCTTGTACCAATCTTACAGTCGGCATTTGCGAA
ATTTTCTTTGAAAAGATTTTGGCTTCAAAACTGGATAGGCCCGTCACTAGCAGGCTCATCTTTGTTTATGCACTGGGCTG
GTGATTTTGACTGCCTTGGTGCGTCTGAAAATAAGAGTGATGGGTTTTATGAAAAAAATGGTTACAATAGCAGTGGTAGT
AGCCGTAATAGCAGCATTAGTTCAACAAGTAGCGCTTCCAGCGGGAGCGGCTGGAGGATGACGTCAAGAACTGGTGATCT
TGACGCTGATGCAGATTCTTTGACGTGTAGGCAATCTGGTCTTACTTGTAATGATGATCGCCTAAAAATGGGTTCCAAGC
GGCCGCGAACAGGGATGGCAGAGTCATTCGGTCAAGTAGGCATTGAAAATGATCAAATTGGTTGGGATTGGGATGCTGAT
GATGATGATGATGACAGAGAAGTTGGCATGGATATCAAGGCACTTCTTTCAGAGTTTGGAGACTTTGGTGACTTCTTTGA
GAACGATGCTTTACCTTTCGGGGAGCCACCGGGAACTGCAGAGTCGCATGTGCTCGTTTTTCCTCCAGATTCTGCTGATG
TAGGTTCCAGTCCCGTGGATATGATGGATGTATCAGACCAAATCGTTTTGCCTGTTGGGTTTTCCTCTTTTGAGAGCTTT
AATCCTGTTCCCCCAATCATTGATGAGTGCCTTATTAAAAGTCAAGAAGTTCTCCACAGCAGTATCACTTCAGTTCCTTC
AAATCAAATGTCGATCTCTTCGACTGGTGAGTTTGATCATTTACTAAAAGCAGAAGCAATGATGACCTTTGCTCCTGAGT
ATGGAGCTGTAGAAGCACCTATGAGCGAGATTTCCTCGACGTTTTTCAAAAGCCCATATCTTCCCAAATCTCATAAAGTG
GAGAGTTCAAATTCAAGAACGAGTAATTATGTCTATGGAGCCACACCACCGACCACTGATTCTGATGGAGCAGGCGATAT
GATTTTGTTCGGATCAAAATCATGCATTGGAAACAATGCTGGCAGAACTCTGTATCATTCGAGGGAGCATTACACTCAAG
TAGAAGGTAGAAAGGGCCGACATGATAAGCTACCTACAGTTATCAGTGACAACAGTAGTACAAAGGAGGGTGTCTCTCAA
TCAATACACTCAAAACATAGTGCTGCGAATGCTGTTAAGGTCGTACAGGGAAAAAAAACTGATGGTATATCTGCTGTTGT
TAGTACCTTATTATCTTCAAAGACCCTGCTGGCAACAGACGTGGGAAGTGTTATGTTCCAAGCTTTCATGTGTAGGATGC
GGCACATAATCACTTCTTCAAAGCACAGTTCACCTGTTAGTCTGACTAGGCTTAGCGGAAACTTTTTCCTTAACCAGCTG
TCAAATGAGCCTAGTACTCTGACAGACAACATATCTGCAAGGAACGAGATATATAAGAAAGATATACCTACCAGAATAGC
TGGAGATTTTGACGGAGGAATGTTGGATAGCCACATGAGTGCACCAGTTGGCGTATGGCGGACTGTTTCAGTCCCAAAAA
CAGCAAAACCTGCTAGTTCGCCAAATATTGAAGCAGGGTCATCCTTGCCCCATAGTTCATTTAGCGAAGACAGCTTACTT
TCTTATGGTCAAAGGCAACCACTGCAGGATCTCCTAGATGGAATAGCGCTACTTGTACAGCAAGCTACCTCTTTTGTTGA
TTTAGCTCTGGATTCAGATTGTGGAGATGGACCTTATGGCTGGCTTGCATTGGAAGAGTTATGGAGACGGGAATTGTCGT
GTGGTCCCTCTGCTGGCCATGCAGGTTGTGGGGGAACTTTGGCTTCCTGCCATTCTCTGGACATTGCTGGTGTCAAGCTT
GTTGATCCACTCTCTGCTGAGGTTTTTCCTTCGTCTGTCATTACTCTTCTGCAATCTGACATCAAAACAGCTCTGAAATC
TGCATTTGGTCAGTCAGATGGTCCATTATCTGTTACAGATTGGTGCAAGGGCCGAAATCAATCGGGGGATGGAGGATCTA
TTTCTGAGGGATTTACTGCTGAGTCAGCCCTGAGTGAAGTCTCAAATGCAATAGATGGTGGGAAAGGAGATGAGACGGCT
CAGAGCCAAGACATATACAGTTCAGAATTACTCCGACCGACACTTTTTGTTCTTCCATCACCTGCTATACTTGTCGGGTA
CCAAGATGACTGGCTTAAGATATCAACAAACTCCTTGACACATTGGGAAAAGGCCCCCTTTGAGCCATATGCTCTGCCAA
AAAGTATTAATTATGCTGTTGTATGCCCGGATATTGATCCTTTAACTTGTGCTGCTACTGATTTCTTCCAGCAGCTTGGA
ACTGTTTATGAAACGTGCAGGCTGGGAACACATTTGCCACAGAGCCTGGGAAATCAAATGGAAAAGGACGTTGGGAGATT
ATCCTCATCTGGATTTGTTCTGCTTGATTGCCCTCAATCAATGAAGATTGAAAGCAATAACACATCGCTTCTGGGATCTC
TCAGCGATTATTTTCTATCTTTATCAAATGGGTGGAATGTGAATAGCTATCTGAAGTCTTTATCAAAAGCGCTGAAAGGT
CTAAAGCTTGGATCAGGCCTTTACACAAACCAAAAAGAAGGATCAGGAAGTCCTTGTGTGGTAGTGTACATAGTGTGTCC
ATTTCCTGACCCTTCGGCAGTTTTAAGAACGATCGTCGAATCGTCTATAGCACTTGGATCAGTAATACAGTCAGATAGAG
ACAGGAGATCAATACTCAACAGTCAAGTTGCAAGGGCGTTTAGTAGTTCTACTGCTGTTGACGAAGCATCAATATCTCAC
ATTCCAGTGCTCTCAGGGTTTAGTGTCCCCAAATTAGTTCTACAAGTGGTGTCTGTTGATTCAATTTTCCGGATAACAAG
TCCAAGCTTTAATGAGCTTGTCATTCTCAAGGATACTGCTTTTTCTGTATACAATAAAGCTAGGAGAATTTCACGAGGAA
TGCCTAATGATGCATTTTTCTCATCATCTTTACCAAGCAGATCGTCTTCAGCGTTGACACCAATGAACTCTATTTCAGGA
ATCTGGAAAGACTGCGGTGGTTCTCGAATGACAGGTTCTACACATCCAAGAGATGGTGAAATTGATGTTAGTTTGAGAAC
GAGTGGTTGGGATACCTCTACTTCCTGGCAGATACCAAGATCTGGAGGATTAAGCTGCGACCCAAACAGAAATGGAGATT
TTTACCTTAATGATGAAATTTTCTATTTATTTGAACCACTTTTCATTCTTTCCGAGCCTGGTTCTGTGGAGCGTGGAGTT
TCACCTACTTTCACCAGCTTGGGTTCTGAGTCTTCCAAGCCAATACCCGAGGATGGTGGCAGAGGTTCTGGACCTGGCAT
GAATTCAATGGAAGGTATAACATCGGGATCAAGCTCCCAGGGGGATGTATCCCAGCTTGAAGGAAAGGCTATTCCAAGTT
TACATTGCTGCTACGGTTGGACAGAGGACTGGAGATGGCTTGTAAGCATCTGGACGGATGCCAGGGGTGAGTTGCTTGAC
ACACATATATTTCCCTTTGGTGGAATTAGCAGTAGACAGGATACAAAAGGGCTGCAGTGTCTTTTCGTTCAAGTTCTGCA
GCAGGGATGTCAAATACTACAGGCGTGCTCCTCCCCTGACAATGGATCTTTCAAACCCAGGGATTTTGTCATTACACGCA
TTGGGAATTTCTTCGAGCTTGAATACCAAGAGTGGCAAAAGGCAATTTACTCAGCTGGAGGTCCTGAGATTAAAAAGTGG
CCTATTCAACTGCGACGTTCTGCGCCTTCTGGCATAGCCACCAACAGCAACGGATCTTCCTTGCAACAGCAGGATCTGAG
TCTGATTCAAGAGAGAGCCTCATCAACTAGCACACTCTACAGCTCTCATTCAAAACAATCCACCTTTGTGAAAGGCAGTA
TGGGGCAATCCGCTGGAAGAAAGCAGATAATGGGTGGGCAGACCATTTCTGGTACTCCAAGGGGATTGTTTCAGTGGGTT
CACAGCATCAGTTTTGCTTCTATTTCACTTGACCATTCCCTGCATTTTGTTCTTCCAGCTGAGTTGGTATCCGCTGGTGG
TGGCCAGAGCAGTACTGGTATGAGTTCCGTTAATTACATTGAAGGTTTCACTCCTGTCAAGTCTCTTGGTTCTACCGCTT
TCTCTTACATGATGATACCATCACCCAACATGCGCTTTCTTCACCCAAGTCCTCTTCAGCTTCCGACATGTTTAACTGCC
GAGTCACCTCCACTTGCTCACCTCCTTCACAGCAAAGGCTATGCAATCCCCTTGTCTACTGGATTTGTTGTTTCAAAAGC
TGTGCCTTCCATGAGAAAAGACTCAAGGATAAACGTGAAAGAAGAATGGCCATCAGTTCTTTCTGTAAGTCTCATAGACT
ATTATGGTGGTTATGACAACGCTCATGACAAAATTCTTCAGGGAATCGTGAAGCAGGGAGGAGGGACCAAAGAAACTAGA
GATTTTGAGGTTGAAAGCCATCTTATCCTTGAGTCAATTGCGGCAGAACTCCATGCTCTATCATGGATGACTGTTAGTCC
AGCATATCTGGACAGGCGGACGGCATTGCCGTTTCACTGTGATATGGTTCTGAGATTGAGACGTCTTCTTCACTTTGCGG
ACAAAGAAGTCTCCAGGATACCTGATAAGACAGGACTGAAAGTTCTGACAACAGACTCGGGTTCTCAGAGTCTCTCTATG
TCTCTGCCTCGGGACCATCTTGATGGTATCTGTTTTCAGCATACAGACTGCAACTTCCTCAGGTGTTGCTCCCCTTTCTT
ATCTGGACACATAAGAAGAGATGGAGAGCAAGTAAATGGACAGATAAAAACGGCGGCCATTTACTACGGCGTTTCTCTCT
TTCCAGGCAAAATAGACAACTTAAATGCTATGGTATGGTCCCATTCTTGTTGCCGGCCACTTTCTTCTATGCATCACATG
GCTTAA