Details for Arabidopsis Locus AT1G55320

Position : Chr1 ( 5`- 20633360 .. 20636892 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55320

Protein [Map View]
MWKSIGELSCDDYVKAGLTLEDAKEFDKLVSDVITKAIETDPRDQWKALVDESVLKPWHPHPLHQLLYYSVYSNWDSSVH
GPPLYWFPSLSQSKSTNLGKLMEYHGPRLLGPSYKNPLESFELFRRFSVEHPEVYWSFVIDELSLVFHTPPRCILNKSKP
EGTWLPDAVLNIAECCLMPSSHPKKEDDSVAVVWRNEGFDDSPVNRMTIKELREQVMLVANAISGSFEKGDTIAIDMPMT
VDAVIIYLAIILAGCIVVSIADSFAAKEIATRLKISKAKGIFTQDYILRGGRRFPLYSRVVEAAPSKVIVLPASGTELHV
QLREQDVSWMDFLSNAKPHSSGENYYRPIYLPVESVINILFSSGTTGEPKAIPWTQLSPIRSACDGWAHLDVQVGHTYCW
PTNLGWVMGPTLMFSCFLTGATLALYSGSPLGRGFGKFVQDAGVTVLGTVPSLVKTWKRTNCMEGLNWTKIKFFATTGEA
SNVDDVLWLSSKADYKPVIECCGGTELASSYIIGSPLQPQAFGAFSTPSMTTRIIIFDENGVPYPDDQPCTGEVGLFPQH
LGATDRLLNANHDEVYFKGMPMYKETRLRRHGDIVKRTVGGYYNVQGRADDTMNLGGIKTSSIEIERVCDQADECISETA
AVTLTPPNGGPELLVIFAVLKEGFKQQSGEELKMKFSRTIQKDLNPLFKVSFVKIVPEFPRTASSKLLRRVLRDQIKQEL
LSLRSRI*

DNA
ATGTGGAAGAGCATAGGCGAATTGAGTTGCGATGATTATGTCAAAGCTGGGTTGACTTTGGAAGACGCCAAGGAATTTGA
CAAATTGGTGAGCGATGTGATTACAAAGGCTATAGAGACTGATCCAAGAGATCAATGGAAAGCTTTGGTAGATGAGAGTG
TGCTTAAGCCATGGCATCCACATCCTCTGCATCAGCTTCTCTACTACTCTGTCTATTCAAACTGGGACTCCTCTGTTCAT
GGCCCTCCTCTCTATTGGTTTCCTTCTCTATCTCAGTCAAAGTCCACCAATCTGGGGAAGCTGATGGAATATCACGGACC
AAGACTTCTTGGTCCTTCATACAAGAACCCTCTTGAAAGTTTTGAACTTTTCCGGAGATTCTCAGTTGAACACCCTGAAG
TTTATTGGTCATTTGTTATCGATGAGCTTTCACTTGTGTTTCACACTCCTCCGAGGTGTATCCTTAACAAATCAAAACCT
GAAGGGACTTGGCTCCCTGATGCAGTTCTTAATATCGCTGAGTGTTGTCTGATGCCTTCAAGCCATCCCAAAAAGGAGGA
TGATAGTGTGGCTGTTGTATGGCGTAATGAAGGGTTTGATGACTCTCCAGTCAATAGAATGACCATTAAAGAGCTTCGGG
AGCAAGTAATGTTGGTGGCAAATGCGATAAGTGGAAGTTTTGAAAAGGGTGACACAATTGCAATCGATATGCCAATGACA
GTTGATGCAGTGATTATATATCTCGCAATCATATTAGCTGGTTGCATTGTTGTCTCCATCGCAGACAGCTTTGCAGCTAA
AGAAATAGCAACAAGGTTGAAAATTTCGAAGGCAAAAGGCATATTCACTCAGGATTATATACTCAGAGGAGGTCGAAGGT
TTCCTTTATACAGTCGAGTGGTTGAAGCTGCTCCATCTAAGGTCATTGTCCTCCCGGCTTCAGGTACTGAATTGCATGTT
CAGTTAAGAGAACAGGATGTATCATGGATGGATTTTCTTTCCAACGCCAAACCCCATTCTAGTGGAGAGAACTACTATCG
TCCGATTTATCTACCTGTAGAGTCTGTGATTAACATTCTCTTCTCATCTGGAACTACAGGTGAGCCGAAAGCTATACCGT
GGACACAACTATCACCAATTCGTAGTGCTTGTGATGGATGGGCTCATCTTGATGTCCAAGTGGGTCACACATATTGTTGG
CCTACAAATCTTGGATGGGTAATGGGACCAACTCTTATGTTCTCCTGCTTTCTAACTGGTGCAACTCTCGCTCTCTACAG
CGGGTCTCCCCTTGGCCGCGGTTTTGGAAAGTTTGTTCAGGATGCTGGAGTTACAGTTCTTGGTACTGTTCCAAGCTTGG
TGAAAACTTGGAAGAGAACAAACTGTATGGAAGGGCTTAATTGGACAAAGATTAAGTTTTTCGCCACTACAGGAGAAGCT
TCCAATGTTGACGATGTTCTCTGGCTTTCTTCTAAAGCTGATTACAAACCTGTGATCGAATGCTGTGGAGGCACGGAACT
TGCTTCGTCATACATCATAGGAAGCCCTCTTCAACCGCAGGCTTTTGGAGCGTTTAGCACACCATCCATGACAACTAGAA
TCATCATCTTCGATGAAAATGGCGTCCCATATCCGGATGATCAACCATGTACTGGAGAAGTCGGTTTGTTCCCCCAGCAC
CTTGGGGCCACGGATAGACTTCTGAATGCAAATCACGACGAGGTTTACTTCAAGGGAATGCCCATGTATAAGGAAACACG
ACTTAGAAGACACGGTGACATTGTGAAGCGAACTGTTGGAGGATATTACAATGTTCAAGGTAGAGCTGATGATACCATGA
ACCTTGGAGGCATTAAGACGAGTTCTATTGAGATCGAACGTGTGTGTGATCAAGCTGATGAGTGCATCTCTGAGACAGCT
GCAGTCACCTTAACACCACCTAACGGTGGTCCAGAGTTGCTGGTCATATTCGCAGTCTTGAAAGAAGGGTTCAAGCAACA
GAGTGGAGAAGAGCTAAAGATGAAATTTTCAAGAACCATTCAAAAAGATCTTAATCCTCTCTTCAAGGTGAGTTTTGTGA
AGATTGTGCCGGAGTTTCCAAGAACAGCTTCTAGCAAGCTACTGAGAAGAGTCTTGAGAGATCAGATTAAGCAAGAACTA
CTATCCTTACGAAGTCGAATATAA