Details for Arabidopsis Locus AT1G55310

Position : Chr1 ( 5`- 20630065 .. 20632973 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55310

Protein [Map View]
MRGRSYTPSPPRGYGRRGRSPSPRGRYGGRSRDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGSHLCTD
TCKASRDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFAEENRKKPTEMRARERGGGSRFRDRRRTPPRYYSRSR
SPPPRRGRSRSRSGDYYSPPPRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRR
SRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTPEPARSRSQSPHGGQYDEDRSPSQ*

DNA
ATGAGGGGAAGGAGCTACACTCCGTCACCACCTAGGGGTTATGGGAGGAGGGGTCGAAGCCCAAGCCCTAGAGGCCGATA
TGGAGGTCGTAGCAGGGACCTCCCGACCAGTCTTTTGGTTCGCAATCTACGCCATGATTGCAGGCAAGAAGATCTCAGGA
AGTCGTTTGAGCAGTTTGGTCCTGTCAAGGACATTTACCTGCCAAGGGATTATTATACCGGAAGTCATCTTTGTACTGAC
ACTTGCAAGGCTAGCAGAGATCCGCGAGGGTTTGGGTTCGTTCAATTTATGGACCCTGCTGATGCTGCTGATGCAAAACA
TCACATGGATGGTTATCTTCTTCTTGGCCGTGAGTTGACTGTCGTGTTTGCAGAAGAGAACAGAAAGAAACCGACTGAAA
TGAGAGCAAGGGAGCGTGGTGGAGGAAGCAGATTTCGGGATAGAAGACGTACTCCACCTCGTTACTACTCTCGCTCTCGT
TCTCCTCCCCCTCGACGTGGTAGATCTCGGTCACGGAGCGGTGACTATTATTCTCCTCCCCCTAGAAGACATCACCCAAG
ATCTATCTCGCCCAGGGAAGAGCGATATGATGGGAGGAGGTCATACTCGCGCTCACCTGCCTCTGATGGCTCAAGGGGTC
GCAGTTTAACTCCAGTCAGAGGTAAGAGCCGCAGCTTAAGCCCCAGCCCTAGAAGAAGCATAAGCCGTAGCCCAAGAAGA
AGCAGGAGCCCAAGCCCAAAAAGAAATAGGAGCGTTAGCCCAAGAAGAAGCATAAGCCGTAGCCCTAGAAGAAGCAGGAG
TCCGAGGAGAAGCAGAAGAAGCTACACTCCTGAACCCGCCAGAAGCAGGAGCCAAAGCCCGCATGGGGGCCAGTATGACG
AAGACCGTTCACCAAGCCAGTGA