Details for Arabidopsis Locus AT1G55300

Position : Chr1 ( 5`- 20628023 .. 20629692 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55300

Protein [Map View]
MEEQFILRVPPSVSERIDRLLSEDASTSDEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVESFKTYDDCALVKTAD
IGQMIMVREPGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRVERDLLNILSGGTVENVSFSFYFRHMMCLYL
LLGFSNFIYLNFFWCRYMSKRNQLRTRMLVMQVRKYLLLHLHLLKSLKLLRQALVIQQELNRREVNQKILMIQCEFIII*

DNA
ATGGAAGAACAGTTCATACTTAGGGTTCCACCGTCTGTTTCAGAACGAATTGATCGGCTTTTAAGCGAGGATGCTTCTAC
TTCCGACGAAATCCCTTTGGATTTGTTTTTTTCAGAGGATGGGAGAAACGGGACGTTTATGATTGGAAACGACGAGTTCC
CGGCTTCTCTGCTTGATCTCCCTGCAGTTGTTGAGTCTTTTAAAACTTATGATGATTGTGCATTAGTCAAAACTGCTGAT
ATTGGGCAGATGATCATGGTTAGGGAGCCTGGTGATCCTGCGCCTAATACAGTTGAATACAGACATGGTCTAACTCCTCC
AATGAAGGATGCTCGAAAGAGGAGATTTCGTCGAGAGCCTGACCTTAATCCGGAGCTTGTACAGCGGGTTGAGAGAGACT
TGTTGAATATATTGAGTGGCGGAACGGTAGAAAATGTAAGCTTTTCTTTCTATTTTCGACACATGATGTGTCTATATTTG
CTCCTTGGATTTAGTAACTTCATTTATTTGAACTTTTTTTGGTGTAGGTACATGAGCAAGAGGAACCAGCTACGAACGAG
AATGCTAGTAATGCAAGTAAGAAAGTATCTTCTTCTTCACCTACACCTGTTGAAAAGCCTGAAGCTCCTGAGACAGGCAC
TAGTAATCCAACAGGAGTTGAACCGGAGAGAAGTGAATCAGAAGATTCTGATGATTCAATGTGAGTTTATTATTATATAA