Details for Arabidopsis Locus AT1G55280

Position : Chr1 ( 5`- 20622960 .. 20624630 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55280

Protein [Map View]
MATESIFLKPVSFAWFTKNPLNQFHKRRQLSYRIRRFRFGVICSKSSDYQDFQSYARPLRLLPAEEVKVFRGNPSFTVSE
SRSLYKVKLQTSNLFGSGISDMNARVLICLIDEKGDSVLQTIPPNLSSLDPEVVENGESFRFQRGSLDEFSFEGPKLGKI
RAFWIGLESGQWRVGRVSLWVVNPRGKETEAKTFCYRYDFEVDELLLGESSDLSMVELRPSRITELADSDQISSSSALNL
DRTMVSNEESMEEYANLKLSLLLYDAVLILLGSLVFSFSLGENSAIAFFFGGTMGFLYLLLLQRSVDELQVPGSSSSENS
NQILSGGLKIPVLSLALAIGLTVLAMRGHIGGEMTAFAVTPKEIVVGTLGFLVCKVAVILAAFKPLKDGP*

DNA
ATGGCGACGGAATCAATTTTTCTCAAGCCTGTATCTTTCGCATGGTTTACGAAAAACCCATTGAATCAATTTCATAAAAG
AAGACAACTTTCCTATCGAATTCGTCGTTTTCGATTCGGTGTAATTTGCTCCAAGTCATCTGATTATCAAGATTTCCAGA
GTTATGCAAGACCTTTGCGTCTCTTACCAGCAGAAGAAGTGAAAGTTTTTAGAGGGAATCCATCTTTCACTGTGAGCGAA
TCTCGATCTCTTTATAAGGTTAAGCTACAGACAAGTAATTTGTTTGGTTCAGGGATTAGTGATATGAATGCTAGAGTTCT
TATATGCTTGATAGACGAAAAGGGCGATTCGGTATTACAGACAATACCTCCAAATTTGTCATCTTTGGATCCAGAGGTTG
TGGAAAATGGTGAAAGCTTCAGGTTTCAGAGGGGCTCTCTTGATGAATTCTCATTTGAAGGACCGAAACTCGGCAAAATC
AGAGCTTTTTGGATTGGTCTTGAGTCTGGTCAATGGAGAGTTGGAAGAGTGAGCTTGTGGGTGGTTAATCCTCGTGGTAA
AGAAACCGAGGCAAAAACCTTTTGTTACCGATATGATTTTGAAGTTGATGAACTCTTGCTTGGAGAGAGCAGTGACCTAT
CAATGGTGGAACTTAGACCTAGCCGTATCACTGAACTCGCTGACTCCGATCAAATCTCTTCGTCTTCAGCTCTGAATCTT
GACCGTACTATGGTTTCCAATGAGGAAAGCATGGAAGAATACGCAAACTTGAAACTCTCTCTGCTACTCTATGATGCGGT
TCTCATCCTTCTTGGAAGTTTGGTCTTTTCCTTCTCACTTGGTGAAAACTCCGCCATTGCTTTCTTCTTCGGTGGAACTA
TGGGATTTCTCTACTTATTGCTATTACAGAGATCAGTTGATGAACTGCAAGTACCGGGATCTTCTTCTTCCGAAAACTCC
AATCAGATACTCAGCGGGGGACTCAAGATTCCGGTTTTGAGCCTTGCATTGGCCATAGGATTAACGGTTTTGGCCATGAG
AGGACACATTGGAGGAGAGATGACTGCATTTGCAGTCACACCAAAAGAGATAGTGGTGGGGACTTTGGGGTTTCTTGTAT
GCAAAGTAGCCGTTATTTTGGCTGCCTTTAAGCCCTTGAAGGATGGTCCTTAA