Details for Arabidopsis Locus AT1G55270

Position : Chr1 ( 5`- 20617954 .. 20620136 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55270

Protein [Map View]
MDLSSQRQSPNGSRGFRLQAPLVDSVSCYCRVDSGLKTVVEARKFVPGSKLCIQPDINPNAHRRKNSKRERTRIQPPLLP
GLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKISWNTFDPISQLWQPLPP
VPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMRRVIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGGECEGIQ
RTLRSAEVYDPNKNRWSFIADMSTAMVPLIGVVYDKKWFLKGLGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLN
GRLYGLDCRDGCKLRVFDESTDSWNKFMDSKAHLGNSKSLEAAALVPLHNKLCIIRNNMSMSLVDVSNPDKNNPRLWENI
AVKGQSKSILSNIWSSIAGRALKSHIVHCQVLQA*

DNA
ATGGATCTATCTTCTCAACGACAATCCCCAAATGGTTCTAGGGGTTTTCGTCTTCAAGCTCCATTGGTGGATTCTGTATC
TTGTTATTGTAGAGTAGATTCCGGTCTTAAGACTGTTGTAGAAGCAAGGAAGTTTGTTCCTGGTTCAAAGCTTTGTATTC
AACCTGATATCAATCCCAATGCTCATAGACGTAAGAATTCTAAGAGGGAGAGGACTAGAATTCAACCTCCGCTTCTCCCT
GGCCTCCCTGACGATCTAGCTGTCGCTTGCCTTATCCGTGTTCCTCGTGCAGAACATAGAAAACTCAGGCTCGTGTGTAA
GAGATGGTATAGGCTTGCTTCTGGGAACTTCTTTTACTCTCAAAGGAAGTTACTTGGGATGTCTGAAGAATGGGTTTATG
TTTTTAAAAGAGATCGTGATGGGAAGATCTCGTGGAATACGTTTGATCCTATCTCTCAGCTTTGGCAGCCGCTTCCACCT
GTTCCAAGGGAATATTCAGAGGCTGTTGGGTTTGGTTGCGCTGTTTTAAGCGGTTGTCATCTTTATTTGTTTGGAGGTAA
GGATCCTTTAAGAGGGTCAATGAGGAGGGTCATTTTCTATAATGCAAGGACGAATAAGTGGCACAGAGCACCGGATATGC
TTAGGAAGCGGCATTTTTTTGGTTGTTGTGTTATAAACAATTGTTTATATGTAGCGGGTGGGGAGTGTGAAGGAATTCAA
AGGACACTTCGCTCAGCTGAGGTTTATGATCCAAACAAGAACAGGTGGAGTTTTATTGCTGATATGAGTACAGCAATGGT
GCCTCTGATCGGTGTGGTTTATGACAAAAAGTGGTTTCTCAAGGGTCTTGGGTCTCACCAACTAGTAATGAGTGAAGCTT
ATGACCCAGAAGTTAATTCATGGAGCCCGGTTAGTGACGGGATGGTTGCTGGTTGGCGTAATCCGTGTACTTCTCTAAAC
GGTCGTCTTTACGGATTGGATTGTAGGGACGGATGCAAACTCAGGGTATTTGATGAATCCACGGATTCATGGAACAAATT
CATGGACAGTAAAGCTCATTTGGGAAACTCGAAGTCGCTTGAAGCTGCAGCTCTTGTTCCTCTACACAATAAGCTTTGTA
TAATCCGGAACAACATGAGCATGAGTCTGGTTGATGTCTCGAATCCTGACAAAAACAACCCTCGACTGTGGGAAAACATT
GCCGTAAAAGGACAGTCCAAGAGCATTCTCAGTAATATATGGTCGAGTATTGCAGGGAGAGCTTTGAAGAGCCATATAGT
GCATTGTCAAGTGCTTCAAGCGTGA