Details for Arabidopsis Locus AT1G55265

Position : Chr1 ( 5`- 20617313 .. 20618005 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55265

Protein [Map View]
MASSLLALFSCLFLSLLSLSSSLNLRRPIFSQSNDLDLFSSLNLDRPSLAADDIHDLLPRYGFPKGLLPNNVKSYTISDD
GDFTVDLISSCYVKFSDQLVFYGKNIAGKLSYGSVKDVRGIQAKEAFLWLPITAMESDPSSATVVFSVGFVSKTLPASMF
ENVPSCSRNLNLQDS*

DNA
ATGGCTTCTTCTTTGCTTGCACTCTTCTCCTGTCTCTTCCTCTCTCTCTTATCTCTCTCCTCCTCCCTAAATCTCCGCCG
TCCGATCTTCTCTCAATCCAACGACCTCGATCTCTTCTCTTCTCTAAATCTCGACCGTCCATCTCTCGCCGCCGATGACA
TCCACGATCTTCTCCCACGCTACGGATTCCCGAAAGGTCTTCTTCCCAACAACGTCAAATCGTACACTATCTCCGACGAC
GGCGATTTCACCGTTGACCTGATTTCCAGTTGCTACGTCAAGTTCTCCGATCAACTCGTTTTCTACGGCAAGAATATCGC
CGGAAAACTCAGTTACGGATCTGTTAAAGACGTCCGTGGAATCCAAGCTAAAGAAGCTTTCCTTTGGCTACCAATCACCG
CCATGGAATCGGATCCAAGCTCTGCCACGGTTGTGTTCTCCGTCGGATTTGTGTCCAAGACTTTACCTGCTTCCATGTTC
GAAAATGTTCCTTCTTGCTCAAGAAACCTAAATCTTCAAGACTCTTGA