Details for Arabidopsis Locus AT1G55260

Position : Chr1 ( 5`- 20614610 .. 20616436 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55260

Protein [Map View]
MIPSSNQYVDTHRVTEDRAIYIHEHTKRLEDTFLSRENTTHRTMEKSTRTLFITIVITSMLLGFGNSDLAQDREECTNQL
IELSTCIPYVGGDAKAPTKDCCAGFGQVIRKSEKCVCILVRDKDDPQLGIKINATLAAHLPSACHITAPNITDCISILHL
PRNSTLAKEFENLGRIEDNYNSTSPTQIHKDGTGGGKAEPVKSNGWKEKSWLGVELLIYLLVSLIFF*

DNA
ATGATCCCATCATCCAACCAATACGTCGACACTCACAGAGTCACAGAGGACAGAGCCATATATATACACGAACATACAAA
GAGACTAGAGGACACGTTTCTATCTAGAGAGAACACAACACATCGAACCATGGAGAAATCAACAAGAACCCTATTCATAA
CCATCGTGATAACCTCCATGTTGCTAGGGTTTGGAAACTCTGATCTTGCTCAGGACAGAGAGGAGTGTACGAACCAGCTC
ATAGAACTATCCACGTGTATTCCGTACGTTGGAGGAGACGCCAAGGCTCCAACAAAAGATTGTTGTGCAGGGTTTGGCCA
AGTTATAAGAAAGAGTGAGAAGTGTGTTTGCATATTGGTCAGAGACAAAGATGATCCTCAACTTGGTATCAAGATTAACG
CAACCCTAGCCGCTCATCTTCCCTCCGCTTGTCATATCACGGCTCCTAACATCACTGACTGTATTTCGATTCTGCATCTA
CCTCGTAACTCAACATTGGCTAAAGAGTTTGAGAACTTAGGAAGGATTGAAGACAACTACAACTCCACATCTCCTACACA
AATTCATAAAGATGGGACAGGAGGAGGAAAAGCCGAACCAGTGAAGAGTAATGGATGGAAGGAGAAGAGTTGGTTGGGTG
TTGAGCTTTTAATATATTTGCTAGTTTCTCTCATCTTCTTTTAA