Details for Arabidopsis Locus AT1G55250

Position : Chr1 ( 5`- 20607030 .. 20612410 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55250

Protein [Map View]
MENQESDEPMQKKPHLLDSVSPNSMARNSSPSHPIAKSVSFFDCDFSLLCLRLVDYEIDVDATVLQLQNQKLVQQLDLQK
KQLYDVESKIQELQLNQTSYDDELISVNQLWNQLVDDLILLGVRAGANQEALNYLDIVDKKRVPPCAADETFLCRLLQVD
SLDTSKSDEVVRKVEEALALRHSSTMELMGLFENTIDTQKTKAESISQSLHAVKSTEDATIQLSSINDLMKEESKNLREM
IDALHVRHKEHSEQIQAYISSHSTDQSELKHLKGQLEEIKAELEENRRKLITLKMQKDAACEGHVTSPAIANGSLSPEKP
VDKTKLRELKDSIDEIKIMAEGRLSELQASQEYNLSLSRQCQDIENELKDDQYIYSSRLYSLINDRIHHWNAELDRYKIL
TEAIQAERSFVMRRDKELNLRAESLEAANHKTTTVGSRIEVLEKKLQSCIIEKNGLELETEEAIQDSERQDIKSEFIAMA
STLSKEMEMMEAQLKRWKDTAQDALYLREQAQSLRVSLSNKADEQKGLEDKCAKQMAEIKSLKALIEKLLKEKLQLQNLA
SICTRECNDDRGLAEIKDSQRKAQAQAEELKNVLDEHFLELRVKAAHETESACQERLATAKAEIAELRTQLDLSEREVLE
LKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNA
SVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELD
DERREKKKLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHLFCQQCIQRSLEIRH
RKCPGCGTAFGQNDVRLVKM*

DNA
ATGGAGAATCAGGAATCGGACGAGCCGATGCAGAAGAAGCCTCATCTTTTAGACTCCGTTTCTCCGAATTCCATGGCTCG
TAACTCTTCACCTTCTCACCCTATAGCTAAAAGTGTAAGCTTTTTCGACTGTGACTTCTCGCTTCTCTGTTTAAGGCTCG
TTGATTATGAAATTGATGTTGATGCCACTGTTCTACAGTTACAGAATCAGAAACTGGTTCAGCAATTAGACCTGCAGAAG
AAACAGCTGTACGATGTTGAAAGCAAGATCCAAGAGTTGCAGCTCAACCAAACGTCTTATGATGATGAACTTATATCAGT
GAACCAGCTTTGGAATCAGTTGGTAGATGACCTGATTTTGCTTGGTGTTCGTGCCGGGGCTAATCAAGAGGCTCTAAACT
ACTTGGACATTGTAGATAAAAAGCGAGTTCCACCATGCGCTGCTGATGAAACGTTTCTATGTAGACTTCTGCAAGTAGAT
TCCTTAGATACTAGTAAGAGTGATGAGGTAGTAAGAAAGGTTGAAGAAGCTCTTGCTTTGCGTCATTCCTCTACAATGGA
GTTGATGGGACTCTTTGAGAACACCATTGATACACAGAAGACGAAAGCTGAAAGCATTTCACAAAGTTTACATGCTGTAA
AATCGACAGAAGATGCCACCATCCAGTTATCTAGCATTAATGATTTGATGAAAGAGGAGTCCAAAAACTTGCGTGAGATG
ATTGATGCTTTACATGTGAGGCACAAAGAACATTCCGAGCAGATTCAGGCGTACATAAGCAGCCATTCAACAGATCAATC
CGAGCTTAAACACCTTAAAGGTCAATTGGAAGAGATCAAGGCTGAGCTTGAAGAAAATAGAAGAAAATTGATAACTCTGA
AAATGCAGAAGGATGCTGCATGTGAAGGTCATGTAACATCACCGGCAATAGCAAATGGAAGTCTTTCTCCTGAGAAGCCT
GTAGATAAAACGAAGTTGCGTGAATTGAAGGACTCCATTGATGAGATAAAGATAATGGCAGAAGGTCGTCTGTCTGAGCT
TCAAGCTTCACAAGAGTATAATCTTTCCTTGTCAAGACAATGTCAAGATATTGAGAATGAACTAAAGGATGACCAGTATA
TATACTCGTCTAGACTGTATAGTTTGATCAATGATCGAATTCATCACTGGAATGCTGAACTGGACCGGTACAAAATTCTG
ACTGAGGCCATTCAGGCTGAAAGGTCCTTTGTAATGAGACGGGATAAGGAACTAAATCTGAGGGCAGAATCTCTAGAGGC
AGCCAACCATAAGACTACCACTGTTGGTTCTAGAATTGAAGTGCTGGAAAAGAAGCTGCAGAGTTGTATAATTGAAAAGA
ATGGATTAGAGCTTGAAACGGAAGAAGCTATTCAAGATTCTGAACGGCAAGATATTAAAAGCGAGTTTATTGCAATGGCA
TCAACCTTATCTAAAGAGATGGAAATGATGGAAGCACAGTTGAAACGGTGGAAGGACACTGCACAAGATGCTCTTTACCT
GCGTGAACAAGCTCAATCGTTGAGAGTTTCGTTAAGTAACAAGGCAGACGAACAGAAGGGTTTGGAGGATAAATGTGCTA
AACAGATGGCGGAAATTAAATCTCTCAAGGCTCTAATTGAGAAACTACTCAAAGAAAAACTACAGCTGCAAAATCTAGCA
AGCATCTGTACGCGTGAATGTAATGATGACAGGGGACTGGCAGAAATCAAGGATTCACAACGGAAAGCCCAAGCTCAGGC
TGAAGAGCTGAAAAACGTTTTGGATGAACACTTTCTTGAATTGAGAGTGAAAGCGGCTCATGAGACTGAGAGTGCTTGCC
AAGAAAGGCTTGCTACCGCCAAGGCTGAAATTGCTGAATTGAGGACTCAGTTAGATCTTTCTGAGAGGGAGGTTTTGGAA
CTTAAGGAGGGTATTAAAGTTAAAGAGCAGGAGGCAGAGGCATCCATTGCTGAAATGGAGACTATAGGTCAAGCCTATGA
AGACATGCAGACACAGAACCAACATTTGTTGCAGCAGGTGGCTGAGCGGGACGATTATAATATCAAGCTTGTTTCCGAAA
GTGTCAAGACAAAGCATGCTTACAACACTCACTTATCTGAGAAGCAAGTAATGGAAAAGCAGCTCCATCAGGTTAATGCA
TCCGTAGAGAATTTTAAAGCAAGGATTGCACATAATGAGGAACAGATGAAAGGCTGTTTTTCTGAGGCTTATAAATTGAT
TCAAGAAGATCGTCACCTCGTTATCAGCCTCGAAACCACCAAATGGGAAGTAGCTGATGCTGACAAGGAATTCAGATGGC
TCAAGTCGGCCGTGTCTTCATCCGAAAAGGAATATGAACAGATCAGTAGGAGGACAGACGACATCAAACTGGAACTGGAT
GATGAAAGGAGGGAGAAGAAGAAGCTTGAGGAAGAGCTTATGGAGTTGAACAAAGAGCTTGAAGAGTTGGGTTCTGAGAG
TGTAGAAGCTGCAATTGTGAGGCTCCAGGAAGAAGTTAAGAATTGCAAAAACATCCTCAAATGTGGTGTATGTTTTGATC
GGCCTAAAGAGGTGGTAATTGTGAAATGTTATCATCTGTTCTGCCAGCAATGCATCCAACGTAGCTTAGAGATCCGACAC
CGGAAATGTCCAGGCTGCGGTACCGCCTTTGGCCAGAATGACGTCCGGCTTGTCAAAATGTAA