Details for Arabidopsis Locus AT1G55230

Position : Chr1 ( 5`- 20602819 .. 20603924 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55230

Protein [Map View]
MGTLVGHVAPGFAFFALGLWHLFNNIKLFCLNPNTFTSSPWFPTSKLRHLELYIIMVCSSISIASELFIGPKKHQPFDSD
GTIPSNHLHNFEHSSISMSFLVYAIFAVVLDQERRRSNISHGLTMLVASSAFAQQLFLFHLHSADHMGIEGQYHKLLQLI
IFVSFLTTLIGITLPKSFLVSFVRSSSITFQGVWFVVMGYMLWTPSLIPKGCFLHEEEGHQVIKCSSDKAIHRAKSLVNI
EFSWFFVGITIFVMSLFLILSGLYGENAEYSILVTKDKGEESGEEKQDIESLKKSKPSFG*

DNA
ATGGGAACACTTGTGGGACATGTTGCACCGGGTTTTGCCTTCTTTGCACTTGGTCTATGGCACTTATTTAACAACATAAA
ACTATTTTGTCTCAACCCAAACACCTTTACTTCATCACCATGGTTTCCAACTTCCAAGCTTAGACATTTAGAGCTCTACA
TAATCATGGTTTGTTCGTCAATCTCCATAGCCTCAGAGCTCTTCATTGGACCCAAGAAACATCAACCCTTTGACTCTGAT
GGTACCATCCCTTCAAACCACCTCCACAACTTTGAACACTCCTCTATCTCCATGTCATTCTTAGTCTACGCGATTTTCGC
AGTAGTTCTTGATCAAGAAAGGCGTAGATCAAATATTTCGCATGGACTGACTATGCTCGTTGCATCTTCTGCCTTTGCTC
AACAGCTCTTCCTTTTCCATCTTCACTCTGCCGACCACATGGGCATTGAGGGACAATACCATAAGCTCCTCCAGCTCATT
ATCTTCGTTTCTTTCCTCACCACTCTAATCGGTATCACTTTGCCTAAAAGTTTCTTGGTAAGCTTTGTGAGGTCATCAAG
CATAACTTTCCAAGGAGTGTGGTTCGTAGTGATGGGTTACATGCTTTGGACACCTAGCTTGATTCCCAAGGGATGTTTTC
TTCACGAAGAAGAAGGACACCAAGTGATTAAATGTTCCAGCGATAAAGCTATACACAGGGCCAAGTCGCTAGTCAACATC
GAGTTTAGTTGGTTCTTTGTTGGAATCACAATTTTTGTAATGTCGCTATTCTTGATCCTAAGTGGGCTTTACGGTGAAAA
TGCCGAGTACTCAATTCTAGTCACTAAAGACAAAGGTGAAGAAAGTGGTGAAGAGAAACAAGACATAGAGTCGCTAAAGA
AAAGTAAACCAAGTTTTGGCTGA