Details for Arabidopsis Locus AT1G55210

Position : Chr1 ( 5`- 20597790 .. 20598708 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55210

Protein [Map View]
MAKLIFFLAVQILFLAVVSSAGDGEDFARTMDRKLLGLHKKEKLTHFKVYWHDILSGPNPTSIMIQPPVTNSSYFGAISM
IDNALTAKVPMNSTVLGQAQGFYAGAAQKELGFLMAMNFAFKTGKYNGSTITILGRNTALSEVREMPIVGGSGLFRFARG
YVEARTKWINLKNGDATVEYSCYVLHY*

DNA
ATGGCTAAGCTCATTTTCTTCCTCGCCGTCCAAATCCTCTTTCTCGCCGTGGTTTCTTCCGCCGGAGACGGTGAAGACTT
CGCTAGAACCATGGACCGGAAACTTCTTGGTCTCCACAAAAAGGAGAAACTTACCCATTTCAAAGTCTATTGGCACGATA
TCTTAAGCGGTCCGAACCCAACCTCCATCATGATACAACCACCGGTTACAAACAGTTCCTATTTTGGAGCCATCTCCATG
ATCGACAACGCTTTGACGGCCAAAGTTCCGATGAACTCCACGGTGTTGGGTCAGGCCCAAGGATTTTACGCCGGAGCGGC
CCAAAAGGAGTTGGGTTTCCTGATGGCGATGAACTTTGCTTTCAAGACAGGGAAATATAACGGAAGCACGATCACGATTC
TTGGCAGGAACACGGCGTTGTCGGAAGTCAGAGAAATGCCGATCGTCGGAGGAAGTGGGCTTTTCCGATTTGCTAGAGGC
TATGTGGAGGCTAGGACAAAGTGGATTAATCTCAAGAACGGTGATGCTACTGTTGAGTATAGTTGTTACGTGTTGCATTA
TTGA