Details for Arabidopsis Locus AT1G55207

Position : Chr1 ( 5`- 20595969 .. 20596498 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55207

Protein [Map View]
MALWTEILTNAAIFVIIQALAFLIISTSSDIFSSKIKMKTKKRSFGFKLSRSISHLFALISDDVFQAEEEEEVAEEG*

DNA
ATGGCTCTGTGGACGGAAATATTGACAAATGCTGCCATTTTTGTGATAATCCAAGCTCTAGCGTTTCTCATAATCTCCAC
TTCTTCCGACATATTCTCCTCCAAGATCAAGATGAAGACAAAGAAGAGATCTTTCGGCTTCAAACTCTCTCGTTCCATTT
CCCATTTATTCGCTTTAATCTCAGATGATGTCTTTCAAGCCGAAGAAGAAGAAGAAGTAGCAGAAGAAGGATAA