Details for Arabidopsis Locus AT1G55205

Position : Chr1 ( 5`- 20594559 .. 20596034 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55205

Protein [Map View]
MASSSKICRLSSKIHSLTQKLSKTNVHISSLPSPIKSSSPSSATSRINQSFRLPVELSCCLSMLPLHSAIASARLISSLS
VESKSWGLVPQGQSFSSLWLYYL*

DNA
ATGGCGTCTTCTTCTAAAATCTGCAGATTATCATCAAAGATTCATTCTTTAACCCAGAAGCTCAGCAAGACGAATGTTCA
CATTTCCTCTTTACCCTCTCCCATTAAATCTTCATCTCCATCCTCAGCAACTTCCCGTATCAATCAATCTTTTAGATTAC
CGGTGGAGCTAAGTTGCTGTTTATCGATGTTGCCACTACACAGTGCTATAGCATCTGCCAGATTGATATCAAGTTTGTCT
GTTGAGTCTAAGAGCTGGGGTTTAGTTCCTCAAGGTCAGTCTTTTTCCTCTCTCTGGCTCTATTACCTTTAA