Details for Arabidopsis Locus AT1G55200

Position : Chr1 ( 5`- 20589129 .. 20592063 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55200

Protein [Map View]
MSREKQGKRSGSNGTEKVLVAVKASREISKTAFVWALTHIVHPGDCITLIVVVTSYNAGRKLWTFPRFAGDCATGHWKLH
SDPMSEIKSDLTDTCSQMILQLHDVYDPNKVNVRIKIVSGSPCGAVAAEAKKSQANWVVLDKHLKHEEKRCIDELQCNIV
AMKRSEAKVLRLNLVGSSTKEPELASEKNKNRLLDSVKAVVTTTPMSSPEVETSFTGTEAWTSSVSSSDLGTSSPVFTAE
VRKDETLVVKENESDSDSESENLSLPSLSKRFQPWISEYLSTHCVSMQESTRGDDKAVQVSTKKALLEKISKLDEGEEAA
MSSKRKDLEEYSGTLRALSRNAPPVSPPLCSICQHKAPVFGKPPRFFSYKELELATNGFSRANFLAEGGFGSVHRGVLPE
GQIVAVKQHKVASTQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEDTRRLLVYEYICNGSLDSHLYGRHKDTLGWPARQKI
AVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDYEPLVGDFGLARWQPDGELGVDTRVIGTFGYLAPEYAQSGQITEK
ADVYSFGVVLIELITGRKAMDIYRPKGQQCLTEWARSLLEEYAVEELVDPRLEKRYSETQVICMIHTASLCIRRDPHLRP
RMSQVLRLLEGDMLMNEISGRFNGRLSTEKGLRDHN*

DNA
ATGAGCAGAGAGAAACAGGGGAAGAGATCAGGTTCTAATGGGACTGAGAAGGTTCTTGTTGCTGTCAAAGCATCTAGGGA
GATTTCAAAGACAGCATTTGTTTGGGCCTTGACTCATATTGTTCATCCTGGAGATTGCATTACTCTGATTGTTGTTGTTA
CTTCTTACAATGCTGGCCGAAAGCTATGGACTTTCCCTAGGTTTGCTGGAGATTGTGCTACTGGTCATTGGAAACTGCAT
TCTGATCCAATGTCTGAGATAAAGAGTGATCTCACTGATACTTGTTCCCAAATGATTCTCCAGCTTCATGATGTATATGA
TCCAAACAAGGTTAATGTCAGGATCAAGATTGTTTCTGGATCACCATGTGGAGCTGTTGCGGCTGAGGCCAAGAAATCTC
AAGCAAATTGGGTAGTTCTTGATAAGCACCTTAAGCATGAAGAGAAACGGTGCATAGATGAGTTACAATGTAACATTGTG
GCGATGAAGCGTTCTGAGGCAAAAGTCCTGCGGTTGAACTTGGTCGGGTCTTCAACAAAGGAACCAGAATTAGCATCTGA
AAAAAACAAAAACAGGTTGTTAGATTCTGTTAAAGCGGTTGTTACAACTACTCCAATGAGCAGTCCTGAGGTTGAGACAT
CATTCACAGGAACAGAAGCTTGGACTTCATCAGTATCTAGCTCTGACCTCGGTACATCATCGCCAGTTTTCACAGCTGAA
GTGAGAAAGGATGAAACTTTGGTCGTCAAAGAGAATGAATCTGATTCTGATTCAGAGAGCGAAAATCTATCACTACCTTC
CTTAAGTAAGAGATTCCAACCATGGATATCAGAATATCTTAGCACTCATTGCGTCTCGATGCAGGAATCAACGAGAGGCG
ATGATAAGGCTGTTCAAGTATCTACTAAAAAGGCTTTGCTTGAGAAAATTTCTAAGCTTGATGAAGGAGAAGAAGCAGCT
ATGTCAAGTAAAAGGAAAGACTTGGAGGAGTATAGTGGAACCTTAAGAGCGTTATCACGAAATGCTCCTCCTGTTTCACC
TCCTCTCTGTTCTATATGCCAGCACAAAGCGCCTGTATTTGGAAAACCACCGAGGTTTTTCTCCTACAAAGAGTTAGAGC
TTGCAACAAACGGGTTTTCGCGAGCTAATTTTTTGGCAGAAGGTGGATTTGGATCTGTTCATAGAGGTGTATTACCTGAA
GGCCAGATTGTAGCAGTAAAGCAACACAAAGTGGCCAGTACACAAGGAGATGTAGAGTTTTGCTCTGAAGTAGAAGTTTT
GAGCTGTGCTCAGCATCGAAACGTAGTTATGTTAATCGGTTTCTGCATCGAAGATACCAGAAGACTCTTGGTCTATGAAT
ACATATGCAATGGATCATTAGACTCTCATCTATACGGTCGCCATAAGGACACTTTGGGATGGCCTGCAAGACAAAAAATA
GCGGTTGGAGCGGCTCGAGGTCTTCGATATCTTCATGAAGAGTGTAGAGTAGGTTGCATTGTTCACCGAGACATGAGGCC
TAACAATATACTAATTACTCATGATTATGAACCACTGGTTGGAGATTTTGGTTTAGCAAGATGGCAGCCTGATGGAGAGC
TAGGTGTAGACACGCGTGTGATAGGAACTTTCGGCTATTTAGCTCCAGAGTATGCTCAAAGTGGACAAATCACAGAGAAA
GCCGATGTTTACTCGTTCGGGGTTGTATTGATCGAACTAATCACGGGTCGTAAAGCAATGGATATCTACAGACCAAAGGG
ACAACAATGTTTAACTGAATGGGCAAGATCTTTATTAGAAGAGTATGCGGTTGAGGAATTAGTTGATCCGAGGCTCGAAA
AGCGATATTCAGAAACACAAGTCATTTGCATGATTCATACAGCTTCATTGTGTATACGTAGAGATCCACATTTGCGTCCT
CGCATGTCTCAGGTGTTGCGTTTATTGGAAGGAGATATGTTAATGAATGAAATCTCAGGGAGGTTTAATGGAAGACTATC
CACTGAGAAAGGTCTCAGAGATCATAACTAA