Details for Arabidopsis Locus AT1G55170

Position : Chr1 ( 5`- 20580274 .. 20581975 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55170

Protein [Map View]
MSGRNRIHRDIRDSYHDHRDLPPERPFLRGPPLLQPPPPSLLEDLQIQEGEIRRQDAEIRRLLSDNHGLADDRMVLEREL
VAAKEELHRMNLMISDLRAEQDLQLREFSEKRHKLEGDVRAMESYKKEASQLRGEVQKLDEIKRELSGNVQLLRKDLAKL
QSDNKQIPGMRAEVKDLQKELMHARDAIEYEKKEKFELMEQRQTMEKNMVSMAREVEKLRAELATVDSRPWGFGGSYGMN
YNNMDGTFRGSYGENDTYLGSSERSQYYSHGSGSQKKPRLDRH*

DNA
ATGTCTGGAAGAAACCGGATTCACAGAGATATCCGAGACAGCTATCATGATCATCGTGATTTACCTCCGGAGAGACCTTT
TCTCCGAGGCCCTCCATTGTTACAACCTCCACCACCATCTTTGTTAGAAGATCTTCAGATACAGGAGGGTGAAATCAGAA
GGCAGGATGCTGAAATCAGAAGGCTTTTGAGTGATAATCATGGACTAGCTGACGACCGAATGGTTCTGGAGAGAGAACTC
GTTGCTGCTAAAGAAGAGCTTCACCGAATGAATCTGATGATTTCTGATCTTCGTGCTGAGCAAGATCTGCAATTGAGGGA
GTTTAGTGAGAAAAGGCATAAACTTGAGGGGGATGTTCGCGCTATGGAGTCGTATAAGAAGGAGGCTTCACAGTTGCGTG
GTGAAGTTCAGAAGCTGGATGAGATTAAACGTGAATTAAGTGGAAATGTTCAGTTGCTTAGGAAAGATTTGGCTAAATTG
CAATCAGATAACAAGCAGATTCCTGGTATGAGAGCTGAGGTTAAAGACCTGCAGAAGGAGCTTATGCATGCTAGAGATGC
AATTGAATATGAGAAGAAGGAAAAGTTTGAGCTTATGGAGCAGCGGCAGACAATGGAAAAGAACATGGTTTCTATGGCGC
GTGAAGTTGAAAAGCTACGCGCAGAACTTGCTACTGTTGATAGTAGGCCGTGGGGTTTTGGTGGATCGTATGGGATGAAT
TACAACAATATGGACGGCACTTTCCGTGGCTCGTATGGCGAAAACGATACTTATTTGGGATCTTCGGAAAGGAGTCAATA
TTACAGCCATGGGTCTGGCTCGCAGAAGAAACCTCGTTTGGATCGTCATTGA