Details for Arabidopsis Locus AT1G55140

Position : Chr1 ( 5`- 20572405 .. 20574348 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55140

Protein [Map View]
MAILSASSTIVRAALDTQPKLRYNPNAPRNVKKNSNLSSFVPPSSPSSSSPATNLSVSVSDLLKRPASKDIGDGFDDTCV
GYEKWFPSPPKVEKPRSVFNAASLAYIGDSIYEIYARRHFLFPPLSIEEYNDRVRAVVRCEAQYALLQKLVDDDFLTKDE
RDILRWGKNVGSVKTRSTRRAGVAVYNKASSLETLIGYLYLSNGKRLEEMMQKLGFSSGSSTERMVKEAGSNKPSFK*

DNA
ATGGCGATTCTATCAGCGAGCTCTACTATAGTGAGAGCTGCTTTAGATACGCAGCCGAAGCTCCGATACAATCCCAATGC
GCCACGCAATGTTAAGAAAAATTCTAATTTGAGTTCTTTTGTTCCACCGTCGTCTCCTTCTTCATCTTCTCCGGCGACAA
ACTTAAGCGTCTCCGTTTCTGATTTACTCAAACGTCCTGCAAGCAAAGATATTGGTGATGGATTTGATGATACTTGTGTT
GGATATGAGAAATGGTTTCCAAGTCCACCAAAAGTGGAGAAACCTAGATCTGTCTTCAATGCTGCCTCATTAGCTTATAT
TGGCGATTCAATCTATGAGATATATGCTCGTAGGCATTTTCTTTTTCCTCCACTTAGTATTGAAGAATATAATGACCGTG
TTAGAGCAGTGGTGCGATGTGAAGCACAATATGCTTTGCTGCAGAAGCTTGTTGATGATGACTTCTTAACGAAAGATGAA
AGAGATATACTTCGGTGGGGAAAAAACGTAGGCTCGGTTAAAACACGGTCAACTAGACGTGCCGGTGTTGCTGTTTATAA
CAAGGCCTCATCATTGGAAACACTAATTGGGTATTTGTATCTATCAAACGGGAAAAGACTGGAAGAAATGATGCAGAAGC
TAGGATTCTCAAGTGGTTCTTCAACAGAGAGAATGGTTAAGGAAGCTGGCTCAAACAAACCATCTTTCAAATAA