Details for Arabidopsis Locus AT1G55090

Position : Chr1 ( 5`- 20554352 .. 20558529 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55090

Protein [Map View]
MRLLKVATCNLNQWAMDFESNMKNIKASIAEAKAAGAVIRLGPELEVTGYGCEDHFLELDTVTHAWECLKELLLGDWTDD
ILCSIGMPVIKGAERYNCQVLCMNRRIIMIRPKMWLANDGNYRELRWFTAWKQREELEEFQLPIEISEALEQKSVPFGYG
YIQFIDTAVAAEVCEELFSPLPPHAELALNGVEVFMNASGSHHQLRKLDIRLNAFMGATHARGGVYMYSNQQGCDGSRLY
YDGCACIVVNGNVVAQGSQFSLRDVEVIISQVDLDAVASLRGSISSFQEQASCKVKVSSVAVPCRLTQSFNLKMTLSSPK
KIIYHSPQEEIAFGPACWMWDYLRRSGASGFLLPLSGGADSSSVAAIVGCMCQLVVKEIAKGDEQVKADANRIGNYANGQ
FPTDSKEFAKRIFYTVFMGSENSSEETKRRSKQLADEIGAWHLDVCIDGVVSAVLSLFQTVTGKRPRYKVDGGSNAENLG
LQNIQARMRMVLAFMLASLLPWVHSKPGFYLVLGSSNVDEGLRGYLTKYDCSSADINPIGSISKMDLRLFLKWAATNLGY
PSLAEIEAAPPTAELEPIRSDYSQLDEVDMGMTYEELSVYGRMRKIFRCGPVSMFKNLCYKWGTKLSPAEVAEKVKYFFK
YYSINRHKMTVLTPSYHAESYSPEDNRFDLRQFLYNSKWPYQFKKIDEIVDSLNGDSVAFPEEEANSNKEIGVVAANSGD
PSAGL*

DNA
ATGAGGCTGTTGAAGGTTGCTACGTGTAACTTGAACCAATGGGCCATGGATTTCGAGAGCAACATGAAGAACATCAAGGC
TTCGATCGCTGAGGCAAAGGCTGCTGGTGCTGTTATCAGGCTTGGACCCGAGCTCGAGGTCACTGGCTATGGTTGCGAGG
ATCACTTCTTGGAACTCGACACTGTCACTCATGCGTGGGAGTGTTTGAAGGAATTGCTGCTTGGTGATTGGACGGATGAT
ATTTTGTGCAGCATAGGAATGCCTGTGATTAAAGGAGCAGAGCGTTATAACTGCCAGGTTCTCTGTATGAACAGAAGAAT
CATCATGATTCGACCGAAAATGTGGCTCGCAAACGATGGAAACTATAGGGAGCTACGGTGGTTCACAGCTTGGAAGCAGA
GAGAAGAGCTAGAGGAATTTCAGCTCCCCATTGAAATTTCAGAGGCTTTGGAGCAGAAATCAGTCCCTTTTGGTTATGGT
TACATCCAGTTTATCGACACGGCTGTTGCAGCTGAAGTCTGTGAGGAACTGTTTAGTCCACTTCCTCCTCATGCCGAGCT
CGCATTGAATGGTGTTGAAGTATTTATGAATGCAAGTGGGAGTCATCACCAACTTAGGAAACTAGATATTCGTCTGAATG
CTTTTATGGGGGCTACTCATGCTCGTGGTGGGGTGTATATGTACAGTAATCAACAAGGATGCGATGGTAGCCGCTTATAC
TACGATGGATGTGCATGTATTGTTGTAAACGGGAATGTTGTTGCTCAAGGCTCACAATTCTCGTTGAGAGACGTTGAGGT
CATCATTTCACAAGTGGATCTTGATGCGGTTGCTAGCCTTCGTGGATCTATAAGTAGCTTTCAGGAACAAGCAAGCTGCA
AGGTTAAAGTATCTTCAGTAGCTGTGCCCTGTAGACTTACACAGTCCTTCAACCTGAAAATGACACTAAGCAGTCCGAAG
AAGATCATTTACCACTCTCCACAAGAAGAAATAGCCTTTGGTCCCGCTTGCTGGATGTGGGACTATTTGAGAAGAAGTGG
CGCTTCAGGATTTTTGCTTCCTCTTTCTGGCGGAGCAGACAGCTCCTCCGTGGCAGCTATTGTTGGCTGCATGTGCCAAC
TTGTTGTTAAAGAGATTGCAAAGGGAGATGAGCAAGTAAAAGCTGATGCGAACCGAATTGGGAATTATGCTAATGGGCAG
TTTCCTACTGATAGCAAAGAGTTTGCCAAACGAATATTTTACACTGTCTTTATGGGTTCTGAAAACAGTTCTGAGGAGAC
AAAAAGGCGTTCAAAGCAGCTGGCAGACGAGATTGGTGCTTGGCATCTTGATGTTTGCATAGATGGTGTTGTCTCTGCAG
TTTTATCATTATTTCAAACAGTTACAGGCAAGCGACCAAGGTATAAGGTTGATGGAGGATCAAATGCTGAGAACCTTGGG
TTGCAGAACATTCAAGCCCGGATGAGAATGGTGTTAGCATTTATGTTAGCGTCTCTCTTGCCTTGGGTTCATAGCAAACC
AGGCTTTTACCTTGTTCTAGGCAGCTCCAACGTTGATGAAGGACTTCGTGGTTACCTGACAAAGTATGATTGCAGCTCAG
CAGACATAAATCCTATAGGAAGTATCAGTAAAATGGATTTGAGGTTGTTCTTAAAATGGGCTGCAACGAATCTCGGATAT
CCATCCTTGGCAGAGATAGAAGCTGCTCCACCAACAGCTGAGCTTGAGCCCATTCGTTCTGACTATTCTCAGCTCGATGA
AGTCGACATGGGAATGACATATGAAGAGCTTTCAGTCTATGGAAGGATGAGGAAGATATTCCGTTGTGGACCAGTATCTA
TGTTCAAGAATCTATGTTACAAGTGGGGAACAAAGCTAAGCCCAGCAGAAGTAGCTGAGAAAGTGAAGTATTTCTTCAAA
TATTATTCGATCAATCGACACAAAATGACTGTCCTCACACCGTCTTATCACGCTGAGAGTTACTCCCCAGAGGACAACAG
ATTCGATCTGAGGCAGTTTCTGTACAACAGCAAGTGGCCATACCAGTTTAAGAAGATTGACGAGATTGTTGACAGCTTAA
ATGGTGACTCAGTTGCTTTCCCGGAAGAAGAAGCAAACTCCAACAAAGAAATTGGAGTTGTAGCAGCAAACTCCGGAGAC
CCAAGTGCGGGTCTCTGA