Details for Arabidopsis Locus AT1G55080

Position : Chr1 ( 5`- 20553011 .. 20554254 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G55080

Protein [Map View]
MDQFSGGGGNWSMIPNVQAQGNFGTPTNHDQQLFLQQQQLQQQQQQQQQQQFHLQQQQQTQQQQQQFQPQQQQEMQQYQQ
FQQQQHFIQQQQFQQQQRLLQSPPLQPQSLQSPPPQQTMVHTPQSMMHTPQQQQQLVQTPVQTPQQHQSLASHFHLYPMV
EKLADVIENGTRDQNSDALVNELNSHFDKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEYRKSIEEIV
TMEH*

DNA
ATGGATCAATTCTCAGGAGGAGGAGGTAATTGGTCGATGATCCCAAACGTGCAGGCGCAAGGTAACTTCGGTACACCGAC
GAATCATGACCAGCAACTATTCCTCCAGCAACAACAATTACAACAACAACAACAACAACAACAACAACAACAGTTTCATC
TTCAACAACAACAACAGACGCAGCAGCAACAACAACAATTCCAGCCACAACAACAACAAGAGATGCAACAATATCAGCAA
TTCCAACAACAGCAACACTTCATCCAACAACAGCAATTCCAACAACAACAACGGTTGTTACAATCTCCTCCTCTTCAGCC
ACAGTCGTTACAATCACCTCCGCCGCAACAGACGATGGTTCACACGCCTCAATCTATGATGCATACACCGCAGCAACAAC
AACAGTTGGTTCAAACTCCGGTGCAGACTCCTCAACAGCATCAGTCTTTAGCTTCTCATTTCCATCTCTATCCGATGGTG
GAGAAATTAGCTGATGTGATCGAAAATGGAACACGAGATCAGAATTCTGACGCCCTGGTGAATGAATTGAATAGCCATTT
CGACAAGTGTCAACAGTTGCTGAATTCGATTTCAGGATCACTAGGATCTAAAACTATGACTGTTGATGGCCAAAAGAGAA
ATGTTGAAGAAAGTGAGCAATTGCTTCAACAGAGAAGGGATTTGATTGTGGAGTATAGGAAATCTATTGAAGAGATTGTG
ACAATGGAGCATTAG