Details for Arabidopsis Locus AT1G26830

Position : Chr1 ( 5`- 9295736 .. 9298541 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G26830

Protein [Map View]
MSNQKKRNFQIEAFKHRVVVDPKYADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHL
KEKSKLIEAAQGGSFLEELNKKWNEHNKALEMIRDILMYMDRTYIESTKKTHVHPMGLNLWRDNVVHFTKIHTRLLNTLL
DLVQKERIGEVIDRGLMRNVIKMFMDLGESVYQEDFEKPFLDASSEFYKVESQEFIESCDCGDYLKKSEKRLTEEIERVA
HYLDAKSEEKITSVVEKEMIANHMQRLVHMENSGLVNMLLNDKYEDLGRMYNLFRRVTNGLVTVRDVMTSHLREMGKQLV
TDPEKSKDPVEFVQRLLDERDKYDKIINTAFGNDKTFQNALNSSFEYFINLNARSPEFISLFVDDKLRKGLKGITDVDVE
VILDKVMMLFRYLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSEDTMRGFYG
SHPELSEGPTLIVQVLTTGSWPTQPAVPCNLPAEVSVLCEKFRSYYLGTHTGRRLSWQTNMGTADIKAIFGKGQKHELNV
STFQMCVLMLFNNSDRLSYKEIEQATEIPAADLKRCLQSLACVKGKNVIKKEPMSKDIGEEDLFVVNDKFTSKFYKVKIG
TVVAQKETEPEKQETRQRVEEDRKPQIEAAIVRIMKSRKILDHNNIIAEVTKQLQPRFLANPTEIKKRIESLIERDFLER
DSTDRKLYRYLA*

DNA
ATGAGTAATCAGAAGAAGAGGAATTTTCAGATAGAGGCGTTTAAGCATCGAGTCGTTGTGGATCCCAAATACGCTGATAA
AACTTGGCAGATTCTTGAGCGTGCGATCCATCAGATTTACAATCAAGATGCTAGCGGTCTCAGTTTCGAAGAACTTTACA
GAAATGCGTACAACATGGTCCTGCACAAGTTTGGTGAGAAGCTATATACTGGGTTTATTGCTACTATGACTTCTCATCTC
AAAGAAAAATCCAAGCTTATCGAGGCAGCTCAGGGAGGGTCGTTTCTAGAAGAGCTTAATAAGAAATGGAATGAGCACAA
CAAAGCGTTAGAGATGATTCGAGACATTCTCATGTATATGGATAGGACTTATATTGAGAGCACCAAAAAGACTCATGTTC
ATCCGATGGGGCTTAACTTGTGGAGGGATAATGTTGTGCATTTCACTAAGATACATACAAGGCTTCTAAACACTCTTCTT
GATCTAGTGCAGAAGGAACGGATAGGTGAAGTTATTGATAGGGGGTTGATGAGGAATGTCATTAAGATGTTTATGGATTT
GGGTGAATCTGTGTATCAGGAGGATTTTGAGAAGCCGTTTTTGGATGCGTCTTCTGAGTTTTATAAGGTTGAGTCTCAGG
AGTTTATTGAATCTTGTGATTGTGGGGACTATCTGAAGAAATCAGAGAAACGCCTTACTGAAGAGATAGAGAGGGTAGCG
CACTACTTAGATGCCAAGAGCGAAGAGAAGATTACTAGTGTGGTTGAGAAAGAGATGATTGCCAACCACATGCAGAGACT
GGTTCACATGGAGAACTCAGGTCTGGTTAATATGCTTCTGAATGACAAGTATGAGGATTTGGGTAGAATGTACAACTTGT
TTCGCAGGGTTACTAATGGTCTTGTTACTGTCAGAGACGTTATGACTTCGCATCTTAGGGAGATGGGAAAACAACTGGTT
ACTGATCCGGAAAAGTCAAAGGATCCGGTGGAATTTGTACAACGTCTATTGGATGAGCGGGATAAATATGACAAAATCAT
CAACACCGCATTTGGCAATGATAAAACCTTTCAGAATGCCCTGAATTCTTCATTCGAGTATTTCATCAACTTGAATGCTC
GTTCTCCTGAGTTTATCTCCCTGTTTGTTGATGACAAGCTACGGAAAGGACTTAAGGGTATCACCGATGTGGATGTTGAG
GTTATCCTTGATAAAGTGATGATGCTGTTCCGTTATTTACAAGAGAAAGATGTCTTTGAGAAGTACTACAAGCAGCATTT
GGCTAAAAGGCTTCTCTCAGGCAAAACTGTGTCAGATGACGCAGAAAGGAGTTTAATAGTGAAACTAAAGACAGAATGTG
GCTATCAGTTCACTTCAAAATTGGAAGGCATGTTCACTGACATGAAGACTTCAGAGGACACAATGCGTGGGTTTTATGGC
AGTCACCCCGAGCTTTCAGAAGGACCTACACTTATTGTTCAGGTACTTACAACTGGTTCTTGGCCAACACAGCCTGCAGT
ACCTTGTAATCTCCCAGCTGAAGTTTCAGTTCTCTGTGAGAAGTTCCGTTCTTACTACCTTGGGACACATACCGGTAGAA
GATTGTCCTGGCAAACAAACATGGGCACAGCAGATATCAAAGCCATCTTTGGAAAGGGTCAGAAACATGAACTGAACGTG
TCGACTTTCCAGATGTGTGTTCTCATGTTGTTCAACAATTCTGATCGACTCAGCTACAAAGAGATCGAACAGGCTACAGA
AATCCCGGCAGCAGATCTTAAACGCTGTTTGCAGTCGCTAGCTTGTGTAAAGGGCAAAAACGTGATAAAGAAAGAACCCA
TGAGCAAAGACATAGGAGAGGAGGATTTGTTCGTTGTGAACGACAAGTTCACTAGCAAGTTTTACAAAGTGAAGATCGGA
ACTGTGGTTGCCCAAAAGGAAACAGAACCGGAGAAGCAAGAGACGAGACAGAGAGTGGAGGAAGACAGAAAACCTCAGAT
TGAAGCAGCCATCGTAAGGATCATGAAGTCCAGGAAAATACTAGACCACAACAACATAATCGCCGAGGTGACGAAACAGT
TGCAGCCACGGTTCCTAGCTAATCCCACGGAGATAAAGAAGAGAATCGAGTCGCTCATTGAACGAGATTTCTTGGAAAGG
GATAGTACAGACCGGAAACTTTACCGCTATCTAGCCTAA